Protein Info for PS417_25860 in Pseudomonas simiae WCS417

Annotation: glycerol-3-phosphate acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 189 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 51 to 74 (24 residues), see Phobius details amino acids 81 to 98 (18 residues), see Phobius details amino acids 109 to 132 (24 residues), see Phobius details amino acids 152 to 172 (21 residues), see Phobius details TIGR00023: acyl-phosphate glycerol 3-phosphate acyltransferase" amino acids 5 to 187 (183 residues), 178.4 bits, see alignment E=7.2e-57 PF02660: G3P_acyltransf" amino acids 8 to 181 (174 residues), 179.1 bits, see alignment E=3.8e-57

Best Hits

Swiss-Prot: 97% identical to PLSY_PSEFS: Glycerol-3-phosphate acyltransferase (plsY) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K08591, glycerol-3-phosphate acyltransferase PlsY [EC: 2.3.1.15] (inferred from 97% identity to pfs:PFLU5588)

Predicted SEED Role

"Acyl-phosphate:glycerol-3-phosphate O-acyltransferase PlsY" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.15

Use Curated BLAST to search for 2.3.1.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UA22 at UniProt or InterPro

Protein Sequence (189 amino acids)

>PS417_25860 glycerol-3-phosphate acyltransferase (Pseudomonas simiae WCS417)
MFWSLAIFAYLLGSLSFAILLSRLTGNPDPRMSGSGNAGATNMLRLAGKKLAVLTLLGDL
CKGLLPVLIASLAGLTLQQQAWIGVCAVLGHLFPLYFRFRGGKGVATAAGMLLGIYPPAA
LLAVLAWLLTFYLTRTSSLAALIATPLTLPLLAWQEPAALLPMSVLTLLIVWRHRGNLRD
LFAGRERHF