Protein Info for PS417_25855 in Pseudomonas simiae WCS417

Annotation: dihydroneopterin aldolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 117 TIGR00526: FolB domain" amino acids 1 to 115 (115 residues), 105.5 bits, see alignment E=2.1e-34 TIGR00525: dihydroneopterin aldolase" amino acids 2 to 114 (113 residues), 83.2 bits, see alignment E=1.9e-27 PF02152: FolB" amino acids 4 to 113 (110 residues), 109.5 bits, see alignment E=6.9e-36

Best Hits

Swiss-Prot: 50% identical to FOLB_SHIFL: Dihydroneopterin aldolase (folB) from Shigella flexneri

KEGG orthology group: K01633, dihydroneopterin aldolase [EC: 4.1.2.25] (inferred from 99% identity to pfs:PFLU5587)

MetaCyc: 50% identical to dihydroneopterin aldolase (Escherichia coli K-12 substr. MG1655)
RXN-10856 [EC: 5.1.99.8]; Dihydroneopterin aldolase. [EC: 5.1.99.8, 4.1.2.25]

Predicted SEED Role

"Dihydroneopterin aldolase (EC 4.1.2.25)" in subsystem Folate Biosynthesis (EC 4.1.2.25)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.2.25 or 5.1.99.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UIK9 at UniProt or InterPro

Protein Sequence (117 amino acids)

>PS417_25855 dihydroneopterin aldolase (Pseudomonas simiae WCS417)
MDRVFIEGLEVDTVIGAYDWERGIRQCLRLDLSFAWDNRPAAAGDDLTLALDYASVSARI
QAFAEKSQYQLVETFAERLAEVLMSEFQIPWLHLKLTKPGAVPAAKGVGVEIERGCR