Protein Info for GFF5043 in Variovorax sp. SCN45

Annotation: ABC transporter, permease protein (cluster 9, phospholipid)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 388 transmembrane" amino acids 143 to 160 (18 residues), see Phobius details amino acids 174 to 199 (26 residues), see Phobius details amino acids 211 to 235 (25 residues), see Phobius details amino acids 269 to 311 (43 residues), see Phobius details amino acids 323 to 346 (24 residues), see Phobius details amino acids 361 to 384 (24 residues), see Phobius details TIGR00056: ABC transport permease subunit" amino acids 169 to 382 (214 residues), 222.8 bits, see alignment E=3.1e-70 PF02405: MlaE" amino acids 172 to 380 (209 residues), 233.6 bits, see alignment E=9.5e-74

Best Hits

KEGG orthology group: K02066, putative ABC transport system permease protein (inferred from 89% identity to vpe:Varpa_0310)

Predicted SEED Role

"ABC-type transport system involved in resistance to organic solvents, permease component USSDB6A"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (388 amino acids)

>GFF5043 ABC transporter, permease protein (cluster 9, phospholipid) (Variovorax sp. SCN45)
MSPAHLPADASAADSAWPRVGQQEQDGRQWTVATGRWTTLAMSSKPAWQALSKSLEAAPA
ADDRAWDLRPIQQLDHIGAQLLWEHWHHAWPATLEMAPQHKAVLDQVAQYTVATPVEPSP
TLNDRVRAFSHNGPRAMIVMRDFTGLLGQLAIDLCALVRAPHRGPWRDFSGHLYQFGATA
LHITALVGLLIGVVLAYLISQQLRQYGAETFVVNILGLSLIRELGPVLAAVLIAGRSGSA
ITAQIGVMRVTEELDAMRVMGIPHGFRLVMPRVLALAIAMPLISLWTSMAALAGGMLAAD
AALNISPSYFLSALPRAVPISNLWLAMAKSAVFGVMIALIGCYFGMKVKPNTESLGRGTT
SSVVTSITAVILVDALFAVLFKGIGFRG