Protein Info for GFF5039 in Sphingobium sp. HT1-2

Annotation: Candidate 1: dienelactone hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 41% identical to DLHH_YEAST: Putative carboxymethylenebutenolidase (YDL086W) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

KEGG orthology group: K01061, carboxymethylenebutenolidase [EC: 3.1.1.45] (inferred from 62% identity to gdi:GDI_3255)

Predicted SEED Role

"Candidate 1: dienelactone hydrolase"

MetaCyc Pathways

4-chlorocatechol degradation (2/5 steps found)
4,5-dichlorocatechol degradation (3/7 steps found)
3,4,6-trichlorocatechol degradation (4/9 steps found)
3-chlorocatechol degradation I (ortho) (1/5 steps found)
3-chlorocatechol degradation II (ortho) (1/5 steps found)
3,5-dichlorocatechol degradation (3/8 steps found)
1,4-dichlorobenzene degradation (3/9 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.45

Use Curated BLAST to search for 3.1.1.45

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (228 amino acids)

>GFF5039 Candidate 1: dienelactone hydrolase (Sphingobium sp. HT1-2)
MRIHLFRPAREARFPALLFFSEIYQVTAPIRRIAAFLAGHGCLVAVPEVYHEYEKAGTVL
PYNSEGTDRGNALKLLKPVGAFDADARAGLDFLTSHPSSTGHVGTIGKCLGGHLALRAAL
DSRVKAAACFYPTDVHSGTLGEGRSDDTFARLNELRAETLFIWGRQDPHIPFEGRERIRS
RLEAVGANYEWLEFNAAHAFMRDEGPRYDPALTVRALLASIALFQRAL