Protein Info for GFF5032 in Sphingobium sp. HT1-2

Annotation: PTS system, inactive IIB catalytic domain / PTS system, fructose-specific IIB component (EC 2.7.1.202) / PTS system, fructose-specific IIC component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 566 transmembrane" amino acids 236 to 260 (25 residues), see Phobius details amino acids 272 to 297 (26 residues), see Phobius details amino acids 309 to 336 (28 residues), see Phobius details amino acids 356 to 385 (30 residues), see Phobius details amino acids 395 to 414 (20 residues), see Phobius details amino acids 432 to 456 (25 residues), see Phobius details amino acids 468 to 489 (22 residues), see Phobius details amino acids 495 to 515 (21 residues), see Phobius details amino acids 535 to 557 (23 residues), see Phobius details TIGR00829: PTS system, Fru family, IIB component" amino acids 106 to 188 (83 residues), 116.9 bits, see alignment E=3.8e-38 PF02302: PTS_IIB" amino acids 107 to 196 (90 residues), 63.9 bits, see alignment E=9.1e-22 TIGR01427: PTS system, Fru family, IIC component" amino acids 221 to 558 (338 residues), 447.9 bits, see alignment E=2.9e-138

Best Hits

KEGG orthology group: K02769, PTS system, fructose-specific IIB component [EC: 2.7.1.69] K02770, PTS system, fructose-specific IIC component (inferred from 76% identity to npp:PP1Y_Mpl7697)

Predicted SEED Role

"PTS system, fructose-specific IIB component (EC 2.7.1.69) / PTS system, fructose-specific IIC component (EC 2.7.1.69)" in subsystem Fructose utilization (EC 2.7.1.69)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.69

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (566 amino acids)

>GFF5032 PTS system, inactive IIB catalytic domain / PTS system, fructose-specific IIB component (EC 2.7.1.202) / PTS system, fructose-specific IIC component (Sphingobium sp. HT1-2)
MSRIFAVVDAGEAGVAGVLAGEALRKAAKASGQAIEIELRTAQGIVNPLPGDADGDLLLI
APEGADAPSENRPHRRLTLEAVLADPVAALHGGKVAGVSSAVPRIVAITSCPTGIAHTFM
AAEGLAEGARQLGYAIRVETQGSVGAGNALTAEEIAAADIVLIAADREVDRSRFAGKRVF
AGNTKPAITGGAKLIERALAEATIQGGEGSASQPAESAAATSGAKRAGPYKHLMTGVSFM
LPFVVAGGLLIALAFALGGIHANDAAAKGTLAYALFEIGAKGGFVLMVPALAGYIAYSVA
DRPGIAPGMIGGMLAANLGAGFLGGIVAGFIAGYGVDWLNRLIQLPKNLQGLKPVLILPL
LGTLLTGLLMLYAVGTPVAAALAFLTDWLRSMQGSSALMLGLILGAMSAFDMGGPVNKAG
YAFSVGLIASQVYTPMAATMAAGMTPPLAVALATRLFRNRFTPEEREAGAAAAVLGLAFI
TEGAIPFAARDPLRVIPALMAGSAVTGAISMAMGVELKVPHGGLFVLPIPGAVTHVGVYA
LAIFAGTLVSALLVGLVKRPIAKIKA