Protein Info for PS417_25760 in Pseudomonas simiae WCS417

Annotation: spermidine/putrescine ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 370 PF00005: ABC_tran" amino acids 27 to 169 (143 residues), 129 bits, see alignment E=2e-41 TIGR01187: polyamine ABC transporter, ATP-binding protein" amino acids 42 to 361 (320 residues), 387.1 bits, see alignment E=3.1e-120 PF08402: TOBE_2" amino acids 286 to 363 (78 residues), 63.4 bits, see alignment E=1.7e-21

Best Hits

Swiss-Prot: 46% identical to POTA_TRIEI: Spermidine/putrescine import ATP-binding protein PotA (potA) from Trichodesmium erythraeum (strain IMS101)

KEGG orthology group: K02052, putative spermidine/putrescine transport system ATP-binding protein (inferred from 99% identity to pfs:PFLU5568)

Predicted SEED Role

"Putrescine transport ATP-binding protein PotA (TC 3.A.1.11.1)" in subsystem Polyamine Metabolism (TC 3.A.1.11.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UA06 at UniProt or InterPro

Protein Sequence (370 amino acids)

>PS417_25760 spermidine/putrescine ABC transporter ATP-binding protein (Pseudomonas simiae WCS417)
MSEVDSNDVLVSFRGVQKSYDGENLIVKDLNLEIRKGEFLTLLGPSGSGKTTSLMMLAGF
ETPTAGEIQLAGRSINNVPPHKRDIGMVFQNYALFPHMTVAENLAFPLSVRALSKTDISE
RVKRVLSMVQLDAFAQRYPAQLSGGQQQRVALARALVFEPQLVLMDEPLGALDKQLREHM
QMEIKHLHQRLGVTVVYVTHDQGEALTMSDRVAVFHQGEIQQIAAPRTLYEEPKNTFVAN
FIGENNRLNGRLHSHSGERCVVELARGEKVEALAVNVGQVGGPVTLSVRPERVSLNGSSE
SCVNRFSGRVAEFIYLGDHVRVRLEVCGKADFFVKQPIAELDPALAVGDVVPIGWQVEHV
RALDPLLEAN