Protein Info for PS417_25750 in Pseudomonas simiae WCS417

Annotation: polyamine ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 415 transmembrane" amino acids 32 to 54 (23 residues), see Phobius details amino acids 201 to 223 (23 residues), see Phobius details amino acids 232 to 256 (25 residues), see Phobius details amino acids 284 to 305 (22 residues), see Phobius details amino acids 336 to 359 (24 residues), see Phobius details amino acids 380 to 403 (24 residues), see Phobius details PF00528: BPD_transp_1" amino acids 216 to 406 (191 residues), 34.1 bits, see alignment E=1.1e-12

Best Hits

KEGG orthology group: K02054, putative spermidine/putrescine transport system permease protein (inferred from 97% identity to pfs:PFLU5566)

Predicted SEED Role

"Spermidine Putrescine ABC transporter permease component PotB (TC 3.A.1.11.1)" in subsystem Polyamine Metabolism (TC 3.A.1.11.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U277 at UniProt or InterPro

Protein Sequence (415 amino acids)

>PS417_25750 polyamine ABC transporter substrate-binding protein (Pseudomonas simiae WCS417)
MAIAVPSNEVSSPTLKQRLARAERLNRWKAQALIAPLVLFLLLVFLVPIVALLFKSVGNP
EVVGGLPRTVVAVTAWDGRGLPGEPVYQALSEDLSEARQNQTLGDLSKRLNMELAGYRSL
LTKTARALPFSEAPASYKEALESLDERWGDPAYWQAIRRNTSSLTPFYLLAAVDHRIDDL
GEVAPATPDQAIYLDIFARTFWMGLVITAVCLLLAYPLAYLLANLPARQSNLLMILVLLP
FWTSILVRVAAWIVLLQSGGLINSALMGMGLIDKPLELVFNRTGVYISMVHILLPFMILP
IYSVMKGISPTYMRAAISLGCHPFTSFWRVYFPQTYAGVGAGCLLVFILAIGYYITPALL
GSPNDQMVSYFVAFYTNTSINWGMATALGGLLLLATVVLYLIYNRLVGASRLRLS