Protein Info for PS417_25735 in Pseudomonas simiae WCS417

Annotation: ribulose-phosphate 3-epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00834: Ribul_P_3_epim
  • amino acids 6 to 203 (198 residues), 292.8 bits, E=1e-91
• TIGR01163: ribulose-phosphate 3-epimerase
  • amino acids 6 to 216 (211 residues), 324.2 bits, E=1.4e-101

Best Hits

Swiss-Prot: 79% identical to RPE_ECO57: Ribulose-phosphate 3-epimerase (rpe) from Escherichia coli O157:H7

KEGG orthology group: K01783, ribulose-phosphate 3-epimerase [EC: 5.1.3.1] (inferred from 99% identity to pfs:PFLU5563)

MetaCyc: 79% identical to ribulose-phosphate 3-epimerase (Escherichia coli K-12 substr. MG1655)
Ribulose-phosphate 3-epimerase. [EC: 5.1.3.1]

Predicted SEED Role

"Ribulose-phosphate 3-epimerase (EC 5.1.3.1)" in subsystem Calvin-Benson cycle or Conserved gene cluster associated with Met-tRNA formyltransferase or Pentose phosphate pathway or Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization (EC 5.1.3.1)

MetaCyc Pathways

• superpathway of glucose and xylose degradation (16/17 steps found)
• formaldehyde assimilation III (dihydroxyacetone cycle) (11/12 steps found)
• pentose phosphate pathway (8/8 steps found)
• pentose phosphate pathway (non-oxidative branch) I (5/5 steps found)
• Bifidobacterium shunt (12/15 steps found)
• heterolactic fermentation (14/18 steps found)
• pentose phosphate pathway (partial) (3/3 steps found)
• Rubisco shunt (8/10 steps found)
• pentose phosphate pathway (non-oxidative branch) II (5/6 steps found)
• Calvin-Benson-Bassham cycle (10/13 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (19/26 steps found)
• ethene biosynthesis V (engineered) (18/25 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (19/27 steps found)
• formaldehyde assimilation II (assimilatory RuMP Cycle) (6/9 steps found)
• oxygenic photosynthesis (11/17 steps found)

KEGG Metabolic Maps

• Carbon fixation in photosynthetic organisms
• Pentose and glucuronate interconversions
• Pentose phosphate pathway

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.3.1

Sequence Analysis Tools

See A0A1N7U7L1 at UniProt or InterPro

Protein Sequence (224 amino acids)

>PS417_25735 ribulose-phosphate 3-epimerase (Pseudomonas simiae WCS417)
MQPFVIAPSILSADFARLGEEVDKVLAAGADFVHFDVMDNHYVPNLTIGPMVCAALRKYG
ITAPIDAHLMVSPVDRIIGDFVEAGATYITFHPEASLHVDRTLQLIHEGGCKAGLVFNPA
TPLSVLEYVMDKVDMILLMSVNPGFGGQKFIPGTLNKLREARALIDASGRDIRLEIDGGV
NVNNIREIAAAGADTFVAGSAIFNAPDYQEVIDKMRAELALARP