Protein Info for GFF5006 in Sphingobium sp. HT1-2

Annotation: Metallo-beta-lactamase family protein, RNA-specific

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 482 PF00753: Lactamase_B" amino acids 47 to 230 (184 residues), 48.3 bits, see alignment E=2.4e-16 PF12706: Lactamase_B_2" amino acids 66 to 244 (179 residues), 27.8 bits, see alignment E=3.6e-10 PF10996: Beta-Casp" amino acids 277 to 395 (119 residues), 115.1 bits, see alignment E=5.9e-37 PF07521: RMMBL" amino acids 409 to 473 (65 residues), 56.1 bits, see alignment E=6e-19

Best Hits

KEGG orthology group: K07576, metallo-beta-lactamase family protein (inferred from 99% identity to sch:Sphch_4173)

Predicted SEED Role

"Metallo-beta-lactamase family protein, RNA-specific" in subsystem Bacterial RNA-metabolizing Zn-dependent hydrolases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (482 amino acids)

>GFF5006 Metallo-beta-lactamase family protein, RNA-specific (Sphingobium sp. HT1-2)
MQKRKKRHHSRVTIFEREARIDLAKRPADGLGVAFLGASGTVTGSRYLVDDGETQIVVDS
GLFQGPRDLRRLNWASIPPEVADVGQVLLTHAHLDHSGALPRMARLGWDGTVLATRATAA
LCELLLPDSGHLQEKDAEFANQHGFSRHQPALPLYTQADARLALQLFRPIEFGAWHAVTD
GIRVRYHRAGHILGAASIEIDWKGRTILFSGDIGRYGDAVMKDPEPPARADYVLVESTYG
DRRHEQVDPTKTLGDHVERCVERGGTVVIPAFAVGRVQSLLYHFSRLRAQGRLRDIPIFL
DSPMAINASGLMCDFMDEHRLARAECEAACSVAHYVREVEESKELTANPAPKVIISASGM
ATGGRVLHHLKRFAPDGKNLILFSGFQAAGTRGAAMIGGARTIKIHGEYIPVEAEVANLT
MLSAHADSDELMRWLGSLQEPPRHVYVTHGEPTGAQVLAKRVSEDLGWACSVPALGSWGM
LA