Protein Info for GFF5004 in Sphingobium sp. HT1-2

Annotation: Putative protein-S-isoprenylcysteine methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 226 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details amino acids 41 to 67 (27 residues), see Phobius details amino acids 101 to 125 (25 residues), see Phobius details amino acids 146 to 176 (31 residues), see Phobius details PF04140: ICMT" amino acids 119 to 188 (70 residues), 30 bits, see alignment E=5.6e-11 PF04191: PEMT" amino acids 120 to 185 (66 residues), 30 bits, see alignment E=6.1e-11

Best Hits

KEGG orthology group: None (inferred from 97% identity to sjp:SJA_C1-04750)

Predicted SEED Role

"Putative protein-S-isoprenylcysteine methyltransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (226 amino acids)

>GFF5004 Putative protein-S-isoprenylcysteine methyltransferase (Sphingobium sp. HT1-2)
MTHADYGYGLWGLALVNAAVFILFAFSFFKPATKRDWRSLGAFSAFIIALFAEMYGFPLT
IFVLSGWLQSYFPAVDWWSHDAGHLLEMMFGWRVNPHYGPFHIASFVLIGVGYWLISVAW
TALHLSQRKHQLALTGIYARIRHPQYVGFILVMLGFLLQWPTLLTLAMFPVLVVMYIRLA
RHEEKEALASFGEVYRDYMARVPGFIPNLTIHSRRRRPWRSFDGNG