Protein Info for PS417_25635 in Pseudomonas simiae WCS417

Annotation: biotin--protein ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF08279: HTH_11
  • amino acids 2 to 54 (53 residues), 45.2 bits, 6.9e-16
• TIGR00121: biotin--[acetyl-CoA-carboxylase] ligase
  • amino acids 78 to 308 (231 residues), 195.4 bits, E=5.5e-62
• PF03099: BPL_LplA_LipB
  • amino acids 83 to 206 (124 residues), 82 bits, E=3.9e-27

Best Hits

KEGG orthology group: K03524, BirA family transcriptional regulator, biotin operon repressor / biotin-[acetyl-CoA-carboxylase] ligase [EC: 6.3.4.15] (inferred from 92% identity to pfs:PFLU5543)

Predicted SEED Role

No annotation

MetaCyc Pathways

• biotin-carboxyl carrier protein assembly (4/4 steps found)

KEGG Metabolic Maps

• Biotin metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.15

Sequence Analysis Tools

See A0A1N7U7J3 at UniProt or InterPro

Protein Sequence (319 amino acids)

>PS417_25635 biotin--protein ligase (Pseudomonas simiae WCS417)
MLTLLKLLKDGRFHSGEALGAALGVSRSAVWKQLQHLEAELNLPIHKVRGKGYQLASPLV
FLTAEDIALNAPSLVWPIHISDSIDSTNAEALRLVGAGCEAPFLVLAEQQTAGRGRRGRK
WVSPFAQNVYYSLVLRIESGLRQLEGLSLVVGLAVMQALRESGVQGAALKWPNDVLVGQK
KIAGILLELVGDPADICHVVLGIGINVNMQRADDVDQQWTSLQLQTGSPVDRNALVARLG
LQLQDYLERHRLGGFIALQEEWEQNHAWQGRPVSLIAGVHQIDGVVLGVDHQGALRLSVD
GVEKIYSGGELSLRLRDDS