Protein Info for PS417_25600 in Pseudomonas simiae WCS417

Annotation: preprotein translocase subunit SecE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 122 transmembrane" amino acids 14 to 33 (20 residues), see Phobius details amino acids 39 to 58 (20 residues), see Phobius details amino acids 93 to 117 (25 residues), see Phobius details TIGR00964: preprotein translocase, SecE subunit" amino acids 70 to 122 (53 residues), 70.3 bits, see alignment E=4.9e-24 PF00584: SecE" amino acids 70 to 121 (52 residues), 72.3 bits, see alignment E=1.2e-24

Best Hits

Swiss-Prot: 79% identical to SECE_PSEAE: Protein translocase subunit SecE (secE) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03073, preprotein translocase subunit SecE (inferred from 100% identity to pfs:PFLU5540)

MetaCyc: 52% identical to Sec translocon subunit SecE (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Preprotein translocase subunit SecE (TC 3.A.5.1.1)" (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UG11 at UniProt or InterPro

Protein Sequence (122 amino acids)

>PS417_25600 preprotein translocase subunit SecE (Pseudomonas simiae WCS417)
MTPKAEAQSSRFDLVKWLAVVALVVVGVVGNQYYSASPILYRVLALLALAAVAAFVGLQT
AKGKSFAVLVKEARTEIRKVVWPTRQETTQTTLIVVAVVLVMALLLWGLDSLLGWLVSLI
VG