Protein Info for GFF4988 in Sphingobium sp. HT1-2

Annotation: Prolyl oligopeptidase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 265 PF01738: DLH" amino acids 16 to 222 (207 residues), 25.3 bits, see alignment E=3.8e-09 PF00561: Abhydrolase_1" amino acids 29 to 121 (93 residues), 41.6 bits, see alignment E=4.3e-14 PF12697: Abhydrolase_6" amino acids 29 to 216 (188 residues), 39.1 bits, see alignment E=4.8e-13 PF12146: Hydrolase_4" amino acids 29 to 138 (110 residues), 30.4 bits, see alignment E=9.1e-11 PF00326: Peptidase_S9" amino acids 49 to 238 (190 residues), 49.9 bits, see alignment E=1.1e-16 PF05728: UPF0227" amino acids 96 to 218 (123 residues), 21.5 bits, see alignment E=6.5e-08

Best Hits

KEGG orthology group: K06889, (no description) (inferred from 56% identity to psa:PST_3159)

Predicted SEED Role

"Prolyl oligopeptidase family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (265 amino acids)

>GFF4988 Prolyl oligopeptidase family protein (Sphingobium sp. HT1-2)
MTGSQICFDVEGESLDATILSPDKLVPGILFIHGWGGSRDQDMVRAEEIAQLGCICFTFD
LRGHARHAEERNRVTRSHGLADVVAAYDYLVGQDQVDPSAIAVVGTSYGGYLAALLTAVR
PVNWLALRVPALYPDEHWDVPKAMLDRDLINAYRARFRTGREDKALAACEQFAGDVLIVE
SEQDDYVPHATISSYMSAFHNSNSLSYRILKGADHSLRDEGCRRAYNQLLLTWIEEMVRG
GRRPSTSSHQDAGELPAQAYKLADR