Protein Info for PS417_25550 in Pseudomonas simiae WCS417

Annotation: elongation factor G

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 701 TIGR00484: translation elongation factor G" amino acids 1 to 700 (700 residues), 1163.1 bits, see alignment E=0 PF00009: GTP_EFTU" amino acids 9 to 288 (280 residues), 203.5 bits, see alignment E=7e-64 TIGR00231: small GTP-binding protein domain" amino acids 9 to 188 (180 residues), 107.5 bits, see alignment E=6e-35 PF22042: EF-G_D2" amino acids 317 to 400 (84 residues), 61.8 bits, see alignment E=1.7e-20 PF03144: GTP_EFTU_D2" amino acids 332 to 399 (68 residues), 67.9 bits, see alignment E=2.5e-22 PF14492: EFG_III" amino acids 412 to 486 (75 residues), 117.9 bits, see alignment E=4.9e-38 PF03764: EFG_IV" amino acids 487 to 606 (120 residues), 150.6 bits, see alignment E=5.3e-48 PF00679: EFG_C" amino acids 609 to 695 (87 residues), 102.6 bits, see alignment E=3e-33

Best Hits

Swiss-Prot: 98% identical to EFG_PSEFS: Elongation factor G (fusA) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K02355, elongation factor G (inferred from 98% identity to pfs:PFLU5530)

Predicted SEED Role

"Translation elongation factor G" in subsystem Translation elongation factor G family or Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UFZ8 at UniProt or InterPro

Protein Sequence (701 amino acids)

>PS417_25550 elongation factor G (Pseudomonas simiae WCS417)
MARTTPISRYRNIGIVAHVDAGKTTTTERVLFYTGKSHKMGEVHDGAATTDWMVQEQERG
ITITSAAITAFWKGSEKQYKDEHRFNVIDTPGHVDFTIEVERSLRVLDGAVVVFCGTSGV
EPQSETVWRQANKYGVPRLVYVNKMDRAGANFLRVIGQIKQRLGHTPVPIQLAIGSEDNF
QGQIDLINMEAVYWNDSDKGMVPVRKPIPAELQELADEWRNNMVEAAAEASEELMNKYLE
GEELTNVEIKAALRQRTIAGEIVLAVCGSSFKNKGVPLVLDAVIDYLPAPTDIPAIKGTN
PDNEEEEMERHADDSEPFSALAFKIATDPFVGTLTFVRVYSGVLASGDGVINSVKGKKER
VGRMVQMHANAREEIKEVRAGDIAALIGMKDVTTGETLCDAAKPIILVRMDFPEPVISVA
VEPKTKDDQEKMGIALGKLAQEDPSFRVKTDEETGQTIISGMGELHLDILVDRMRREFNV
EANIGKPQVSYRERITKNCEIEGKFVRQSGGRGQFGHCWIRFAPADEGQEGLQFVNEVVG
GVVPKEYIPAIQKGIEEQMKNGVVAGYPLIGLKATVFDGSYHDVDSNEMAFKVAASMATK
QLAQKGGGELLEPIMAVEVVTPEDYMGDVMGDLNRRRGMILGMEDTVSGKVIRAEVPLGE
MFGYATDVRSMSQGRASYSMEFKKYNTAPAHIAETVSKKQG