Protein Info for GFF4985 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Nucleoside-diphosphate-sugar epimerases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 488 PF07992: Pyr_redox_2" amino acids 47 to 262 (216 residues), 29.2 bits, see alignment E=1.3e-10 PF13454: NAD_binding_9" amino acids 49 to 192 (144 residues), 35.1 bits, see alignment E=2.7e-12 PF13738: Pyr_redox_3" amino acids 50 to 262 (213 residues), 38.4 bits, see alignment E=1.8e-13 PF13434: Lys_Orn_oxgnase" amino acids 130 to 262 (133 residues), 38.2 bits, see alignment E=1.9e-13

Best Hits

KEGG orthology group: None (inferred from 66% identity to reh:H16_A1586)

Predicted SEED Role

"Nucleoside-diphosphate-sugar epimerases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (488 amino acids)

>GFF4985 Nucleoside-diphosphate-sugar epimerases (Hydrogenophaga sp. GW460-11-11-14-LB1)
MTPTTSLDGSAGLAALEARLAEDLSRLELPAKRWVFPRTHEGAPVLDVAVIGAGQFGLAA
SAALRHLGIETINFDAAPAGLEGPWATTARMETLRSPKELTGPALGFASLTFRAWFESQW
GKTAWAALDKIPRLQWMDYLRWYRKVMALDVRNQHTVTKIEPLPDGLVRLGMDTPSGPQV
HTARRVVLATGYDGLGGRRLPAFVDGLPTDRWCHSSDVFDFNRLRGLRVGVVGAGASSMD
SAASALEAGAASVDLLIRRRDIPRINKVKGAGNSGFSFGHWDLPDEDKWRIRHYINVQQV
PPPRASVQRVSRHANARFHLGCPVLDVQAVGDGLRVTTPEQTMNFDFMVFSTGFHIDWSE
RAAFAPFAAHVRSWGDRFVAPPGQDDAELASSPDLGRAFELQERVPGACPGLDHIHCFNF
PSALTHGYVSGDIPGISVAARRLSEGIASLLYRENFPRYFEAIEAFAEPEVFGDEWTPYR
PQKESIAS