Protein Info for GFF4982 in Sphingobium sp. HT1-2

Annotation: Na+/H+ antiporter NhaA type

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 421 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 43 to 61 (19 residues), see Phobius details amino acids 75 to 98 (24 residues), see Phobius details amino acids 104 to 126 (23 residues), see Phobius details amino acids 135 to 154 (20 residues), see Phobius details amino acids 160 to 178 (19 residues), see Phobius details amino acids 190 to 218 (29 residues), see Phobius details amino acids 284 to 302 (19 residues), see Phobius details amino acids 313 to 333 (21 residues), see Phobius details amino acids 361 to 384 (24 residues), see Phobius details amino acids 395 to 415 (21 residues), see Phobius details PF06965: Na_H_antiport_1" amino acids 1 to 412 (412 residues), 374 bits, see alignment E=4e-116 TIGR00773: Na+/H+ antiporter NhaA" amino acids 1 to 410 (410 residues), 311.3 bits, see alignment E=4.6e-97

Best Hits

Predicted SEED Role

"Na+/H+ antiporter NhaA type" in subsystem Na(+) H(+) antiporter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (421 amino acids)

>GFF4982 Na+/H+ antiporter NhaA type (Sphingobium sp. HT1-2)
LLVATFVALLCVNLPISGAYERFWDTPLVLSFGEAKVSHSLAEWIDHALLPLFFIVIGVD
VKRELTIGALTRWRTAAFPIVGALGGLIVPVLLFLAVADGTEAARGWGIVITMDTAFGLS
VIALFSARLPAGVRALFLAFAAIDDIGGLLAIAFGYSDHFAWEGAVLAGFAIALIILLRR
LHWVASVPYVLLAALVWIGIFQSGVHATIAGVLIGFLVPVRPRLDRSEFAVSVQHRVDQF
QEAHERARVTEDEHEAEIAQGRAEDRLGFLHEMTGATDKSGERLILTLTPWISYVVLPLF
ALSNIRIRLSMDLLTTAATSTLALAIVIGLTVGKPLGFLTFSWIAARCGLARLPEGVDWR
MIAAIGCLAGIGFTISLFIAGLAFPGGEQLDKASLAVLVSSILSGAIGMMALATIPPTSK
A