Protein Info for PS417_25520 in Pseudomonas simiae WCS417

Annotation: 50S ribosomal protein L2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 274 TIGR01171: ribosomal protein uL2" amino acids 3 to 274 (272 residues), 426.5 bits, see alignment E=2.3e-132 PF00181: Ribosomal_L2_N" amino acids 32 to 118 (87 residues), 123.4 bits, see alignment E=3.2e-40 PF03947: Ribosomal_L2_C" amino acids 126 to 251 (126 residues), 190.8 bits, see alignment E=8.3e-61

Best Hits

Swiss-Prot: 100% identical to RL2_PSEPF: 50S ribosomal protein L2 (rplB) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K02886, large subunit ribosomal protein L2 (inferred from 99% identity to pst:PSPTO_0629)

MetaCyc: 78% identical to 50S ribosomal subunit protein L2 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"LSU ribosomal protein L2p (L8e)" in subsystem Ribosome LSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7ULQ9 at UniProt or InterPro

Protein Sequence (274 amino acids)

>PS417_25520 50S ribosomal protein L2 (Pseudomonas simiae WCS417)
MAIVKCKPTSPGRRFVVKVVNQELHKGAPHAPLLEKKSKSGGRNNNGRITTRHIGGGHKQ
HYRLVDFRRNDKDGIAATVERIEYDPNRTAHIALLLYADGERRYIIAPKGVSAGDQLIAG
ALAPIKPGNALQLRNIPVGSTVHGIELKPGKGAQIARSAGASAQLIAREGVYVTLRLRSG
EMRKVLAECRATLGEVSNSEHSLRSLGKAGAKRWRGVRPTVRGVAMNPVDHPHGGGEGRT
SGGRHPVSPWGFPTKGAKTRGNKRTDKMIVRRRK