Protein Info for GFF4970 in Sphingobium sp. HT1-2

Annotation: Hexuronate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 411 transmembrane" amino acids 9 to 27 (19 residues), see Phobius details amino acids 47 to 67 (21 residues), see Phobius details amino acids 78 to 97 (20 residues), see Phobius details amino acids 136 to 161 (26 residues), see Phobius details amino acids 167 to 187 (21 residues), see Phobius details amino acids 214 to 235 (22 residues), see Phobius details amino acids 242 to 266 (25 residues), see Phobius details amino acids 283 to 304 (22 residues), see Phobius details amino acids 310 to 330 (21 residues), see Phobius details amino acids 342 to 365 (24 residues), see Phobius details amino acids 377 to 396 (20 residues), see Phobius details PF07690: MFS_1" amino acids 17 to 361 (345 residues), 163.1 bits, see alignment E=9e-52 PF00083: Sugar_tr" amino acids 35 to 186 (152 residues), 33.4 bits, see alignment E=2.4e-12

Best Hits

Predicted SEED Role

"Hexuronate transporter" in subsystem Alginate metabolism or D-Galacturonate and D-Glucuronate Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (411 amino acids)

>GFF4970 Hexuronate transporter (Sphingobium sp. HT1-2)
MIEGKARKIRWAILAMLFTSTVINYLDRQALSILATTVQQDLHMDDIAYARVVQAFLIAY
TFAYLMAGRVTDWLGTRLSLALFVGWWSLANLLTGFVRSAGELGAARFALGLGEAGNYTA
GPKAVSEHFPPKERGIALGIYTAGAMIGATLAPPLIAGIALHFGWRAAFIATGATGLVWL
VVWLMVYPRSAPEPKEERISEGALWGRILRDRSVWLLAGARAVADPVWYFYLFWFPKYLT
DIYGLTLIAVASMAWIVYLAADLGSIGGGFFSSRLIARGVAPATSRIIVMGAAALVAPLG
AIAASHPALPVLFALASAVAFAHLVFQINISTLIVDLYPTRIVATVFGVVAAGSGLGGLL
STQLVGQLVAGGAFERSFLLMALLHPIAFLLAFLALRSARRSNGEGQLVHA