Protein Info for PS417_25435 in Pseudomonas simiae WCS417

Annotation: preprotein translocase subunit SecY

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 442 transmembrane" amino acids 21 to 40 (20 residues), see Phobius details amino acids 75 to 97 (23 residues), see Phobius details amino acids 118 to 143 (26 residues), see Phobius details amino acids 150 to 169 (20 residues), see Phobius details amino acids 180 to 198 (19 residues), see Phobius details amino acids 210 to 232 (23 residues), see Phobius details amino acids 267 to 290 (24 residues), see Phobius details amino acids 311 to 332 (22 residues), see Phobius details amino acids 367 to 387 (21 residues), see Phobius details amino acids 393 to 412 (20 residues), see Phobius details TIGR00967: preprotein translocase, SecY subunit" amino acids 21 to 424 (404 residues), 427.3 bits, see alignment E=3.1e-132 PF00344: SecY" amino acids 75 to 412 (338 residues), 387.6 bits, see alignment E=2.4e-120

Best Hits

Swiss-Prot: 94% identical to SECY_PSEAE: Protein translocase subunit SecY (secY) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03076, preprotein translocase subunit SecY (inferred from 100% identity to pfs:PFLU5507)

MetaCyc: 64% identical to Sec translocon subunit SecY (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Preprotein translocase secY subunit (TC 3.A.5.1.1)" (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UIC0 at UniProt or InterPro

Protein Sequence (442 amino acids)

>PS417_25435 preprotein translocase subunit SecY (Pseudomonas simiae WCS417)
MAKQGALSALGKGGMSELWARLRFLFLAIIVYRIGAHIPVPGINPDRLADLFRQNEGTIL
SLFNMFSGGALERMSIFALGIMPYISASIIMQLMTAVSPQLEQLKKEGEAGRRKISQYTR
YGTVVLALVQAIGMSVGLAGQGVAFTGDFGFHFVAVSTFVAGAMFMMWLGEQITERGVGN
GISMLIFAGIVAGLPRAIGQSFESARQGDINIFALVAIGLLAVAIIGFVVFIERGQRRIA
VHYAKRQQGRKVFAAQTSHLPLKVNMAGVIPAIFASSILLFPASLGTWFGQSENMGWLQD
LSQSIAPGQPLNILLFSAGIIFFCFFYTALMFNPKDVAENLKKSGAFIPGIRPGEQSARY
IDGVLTRLTLFGALYMTAVCLLPQFLVVAANVPFYLGGTSLLIVVVVVMDFMSQVQSHLV
SHQYESLMKKANLKGYGSGMLR