Protein Info for GFF4962 in Sphingobium sp. HT1-2

Annotation: Putative diguanylate cyclase (GGDEF domain) with PAS/PAC sensor domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 382 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 35 to 56 (22 residues), see Phobius details amino acids 62 to 80 (19 residues), see Phobius details amino acids 92 to 111 (20 residues), see Phobius details amino acids 117 to 139 (23 residues), see Phobius details amino acids 151 to 173 (23 residues), see Phobius details amino acids 185 to 210 (26 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 215 to 378 (164 residues), 153.5 bits, see alignment E=2.1e-49 PF00990: GGDEF" amino acids 219 to 374 (156 residues), 141.8 bits, see alignment E=8.6e-46

Best Hits

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (382 amino acids)

>GFF4962 Putative diguanylate cyclase (GGDEF domain) with PAS/PAC sensor domain (Sphingobium sp. HT1-2)
MSAPAVILSLLFGTALVMTIAMGVSWLHFGRQRHVLTWTASYAVAILQWIANAGGYFLHS
RWLFILTGIGLIVSASLLGIGIRQRSGRPLQLLAFAVPAVLVSLAMAIAIGPVGSQIMQG
MIIPAYVGLLMAVSALSLWPRNRSFTPPELAFFAALLAFALGQLALATSAGLIRGPDEGK
ELYRAILGLFMPTVYVGTAVTAVLVVAGDLAQQLRQQMMHDPLTNILNRRGIEEAAERAI
ANARRQGRPVALVICDLDGFKGLNDGYGHMAGDAALRGFAHLLTNAVRRGDVVGRLGGDE
FGLLMVDTGAEVAADAMERVRAEISCLRLGEAPQALLRASFGVTDLRPDDRELDDLVARA
DAALYAAKREGKNRVTVARAAA