Protein Info for GFF4955 in Sphingobium sp. HT1-2

Annotation: tRNA threonylcarbamoyladenosine biosynthesis protein TsaE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 152 TIGR00150: tRNA threonylcarbamoyl adenosine modification protein YjeE" amino acids 11 to 133 (123 residues), 102.8 bits, see alignment E=6.6e-34 PF02367: TsaE" amino acids 13 to 129 (117 residues), 115.5 bits, see alignment E=7.9e-38

Best Hits

KEGG orthology group: K06925, UPF0079 ATP-binding protein (inferred from 81% identity to sch:Sphch_0731)

Predicted SEED Role

"TsaE protein, required for threonylcarbamoyladenosine t(6)A37 formation in tRNA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (152 amino acids)

>GFF4955 tRNA threonylcarbamoyladenosine biosynthesis protein TsaE (Sphingobium sp. HT1-2)
VAELDMILEGEGAQLDLGRRLARHVRIGDVIALEGGLGAGKTTLARGLLEGLGLEGEAPS
PSFAIVQPYDIPDVRLPVAHVDLYRLDDAEEAAELALDEYLQDSLLIIEWPDRLGDGLWS
HALFLTIMIEPDGARRLTARVPDAWTDRWSQI