Protein Info for PS417_25385 in Pseudomonas simiae WCS417

Annotation: single-stranded DNA-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00621: single-stranded DNA-binding protein
  • amino acids 2 to 171 (170 residues), 199.1 bits, E=3.2e-63
• PF00436: SSB
  • amino acids 5 to 107 (103 residues), 126.5 bits, E=2.1e-41

Best Hits

Swiss-Prot: 87% identical to SSB_PSESM: Single-stranded DNA-binding protein (ssb) from Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)

KEGG orthology group: K03111, single-strand DNA-binding protein (inferred from 99% identity to pfs:PFLU5496)

MetaCyc: 58% identical to ssDNA-binding protein (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Single-stranded DNA-binding protein" in subsystem DNA repair, bacterial or DNA repair, bacterial RecFOR pathway or pVir Plasmid of Campylobacter

Sequence Analysis Tools

See A0A1N7UIA9 at UniProt or InterPro

Protein Sequence (171 amino acids)

>PS417_25385 single-stranded DNA-binding protein (Pseudomonas simiae WCS417)
MARGVNKVILVGTCGQDPEVRYLPNGNAVTNLSLATSEQWTDKQTGQKVEKTEWHRVSMF
GKVAEIAGEYLRKGSQVYIEGKLQTREWEKDGIKRYTTEIVVDMQGTMQLLGGRPQGDQQ
GQGGMSNSAPRPQQSRPQPSQQPQRESRPAPQQAAPQPAPDFDSFDDDIPF