Protein Info for GFF4950 in Sphingobium sp. HT1-2

Annotation: Thioredoxin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00085: Thioredoxin
  • amino acids 4 to 103 (100 residues), 119 bits, E=1.7e-38
• TIGR01068: thioredoxin
  • amino acids 7 to 104 (98 residues), 132 bits, E=3.8e-43
• PF13098: Thioredoxin_2
  • amino acids 16 to 105 (90 residues), 37.3 bits, E=6.1e-13
• PF13905: Thioredoxin_8
  • amino acids 19 to 62 (44 residues), 27 bits, E=9.5e-10
• PF14595: Thioredoxin_9
  • amino acids 27 to 97 (71 residues), 28.3 bits, E=2.8e-10

Best Hits

Swiss-Prot: 62% identical to THIO_RHOSH: Thioredoxin (trxA) from Rhodobacter sphaeroides

KEGG orthology group: K03671, thioredoxin 1 (inferred from 93% identity to sjp:SJA_C1-16510)

MetaCyc: 61% identical to reduced thioredoxin 1 (Escherichia coli K-12 substr. MG1655)
RXN-20161 [EC: 1.8.4.16]

Predicted SEED Role

"FIG149041: Thioredoxin"

MetaCyc Pathways

• periplasmic disulfide bond reduction (1/2 steps found)
• cytochrome c biogenesis (system I type) (3/11 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.4.16

Protein Sequence (106 amino acids)

>GFF4950 Thioredoxin (Sphingobium sp. HT1-2)
MATKAVTDVSFKQDVIDADKPVLVDFWAEWCGPCKMIGPALEEISEELADKVTIAKINID
ENPDAPGQYGVRGIPTMILFKNGEVAATKVGAAPKSALKGWIESVL