Protein Info for GFF495 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00108: Thiolase_N
  • amino acids 13 to 223 (211 residues), 73.9 bits, E=2.8e-24
• PF00109: ketoacyl-synt
  • amino acids 60 to 128 (69 residues), 29.1 bits, E=1.5e-10
• PF22691: Thiolase_C_1
  • amino acids 244 to 383 (140 residues), 125.5 bits, E=2.8e-40
• PF02803: Thiolase_C
  • amino acids 248 to 352 (105 residues), 34.1 bits, E=3.9e-12

Best Hits

Swiss-Prot: 43% identical to Y793_METTH: Uncharacterized protein MTH_793 (MTH_793) from Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)

KEGG orthology group: K00626, acetyl-CoA C-acetyltransferase [EC: 2.3.1.9] (inferred from 45% identity to mem:Memar_2362)

Predicted SEED Role

No annotation

MetaCyc Pathways

• oleate β-oxidation (28/35 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (21/27 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (20/26 steps found)
• (2S)-ethylmalonyl-CoA biosynthesis (4/4 steps found)
• acetyl-CoA fermentation to butanoate (6/7 steps found)
• ketolysis (3/3 steps found)
• acetoacetate degradation (to acetyl CoA) (2/2 steps found)
• ketogenesis (4/5 steps found)
• pyruvate fermentation to acetone (4/5 steps found)
• polyhydroxybutanoate biosynthesis (2/3 steps found)
• pyruvate fermentation to butanol II (engineered) (4/6 steps found)
• superpathway of Clostridium acetobutylicum acidogenic fermentation (6/9 steps found)
• glycerol degradation to butanol (11/16 steps found)
• (R)- and (S)-3-hydroxybutanoate biosynthesis (engineered) (3/5 steps found)
• glutaryl-CoA degradation (3/5 steps found)
• isopropanol biosynthesis (engineered) (3/5 steps found)
• ethylmalonyl-CoA pathway (7/11 steps found)
• pyruvate fermentation to hexanol (engineered) (7/11 steps found)
• 3-hydroxypropanoate/4-hydroxybutanate cycle (12/18 steps found)
• pyruvate fermentation to butanoate (4/7 steps found)
• L-glutamate degradation V (via hydroxyglutarate) (6/10 steps found)
• superpathway of geranylgeranyldiphosphate biosynthesis I (via mevalonate) (6/10 steps found)
• valproate β-oxidation (5/9 steps found)
• 2-deoxy-D-ribose degradation II (4/8 steps found)
• mevalonate pathway I (eukaryotes and bacteria) (3/7 steps found)
• mevalonate pathway II (haloarchaea) (3/7 steps found)
• L-lysine fermentation to acetate and butanoate (5/10 steps found)
• superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (10/17 steps found)
• superpathway of Clostridium acetobutylicum solventogenic fermentation (7/13 steps found)
• isoprene biosynthesis II (engineered) (3/8 steps found)
• mevalonate pathway III (Thermoplasma) (3/8 steps found)
• mevalonate pathway IV (archaea) (3/8 steps found)
• pyruvate fermentation to butanol I (3/8 steps found)
• 4-oxopentanoate degradation (3/9 steps found)
• L-glutamate degradation VII (to butanoate) (5/12 steps found)
• 2-methylpropene degradation (2/8 steps found)
• methyl tert-butyl ether degradation (2/10 steps found)
• L-tryptophan degradation III (eukaryotic) (4/15 steps found)
• benzoate fermentation (to acetate and cyclohexane carboxylate) (5/17 steps found)
• crotonate fermentation (to acetate and cyclohexane carboxylate) (4/16 steps found)
• toluene degradation VI (anaerobic) (3/18 steps found)
• superpathway of ergosterol biosynthesis I (5/26 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (25/56 steps found)
• superpathway of L-lysine degradation (13/43 steps found)
• superpathway of cholesterol biosynthesis (5/38 steps found)

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Butanoate metabolism
• Fatty acid metabolism
• Lysine degradation
• Propanoate metabolism
• Pyruvate metabolism
• Synthesis and degradation of ketone bodies
• Terpenoid biosynthesis
• Tryptophan metabolism
• Valine, leucine and isoleucine degradation

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.9

Use Curated BLAST to search for 2.3.1.9

Protein Sequence (387 amino acids)

>GFF495 hypothetical protein (Xanthobacter sp. DMC5)
MRPVFVAGIGSSAFGRHPETSIEALAIRAADAAIRESGLDRSDIGALYLGNFVAGPLLGQ
EVLAGLVADGLGLPQIPCTKVEGACASGGIAFRHAYLAVATGMCDMALAVGAEKMTHADT
AAVTSALNCAMDFRSDGVSGLTFPGLFGLAWRLYEQRYGATRDDISAVVRKNKGNGLKNP
LAQMGADLSTQEIGNARLICDPLRLYDCCPASDGAAAVLLVSADRLRDVIPQPVQVLASA
QARGSARIAGHPDLCTFEATVAAAQGAYAQAGITADEVSCVELHDCFSIAEIIDAEDLGL
MPRGAGAGYAAEGRTAVDGDRPINASGGLLAKGHPVGATGLGQIYESVLQLRGMHTNQVK
GARVALTHNLGGTGVACTVNILRATDA