Protein Info for PS417_25365 in Pseudomonas simiae WCS417

Annotation: trans-aconitate methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 253 PF13489: Methyltransf_23" amino acids 12 to 172 (161 residues), 56.8 bits, see alignment E=8.1e-19 PF01728: FtsJ" amino acids 30 to 100 (71 residues), 25.7 bits, see alignment E=3.4e-09 PF13847: Methyltransf_31" amino acids 34 to 141 (108 residues), 67.1 bits, see alignment E=4.8e-22 PF13649: Methyltransf_25" amino acids 35 to 123 (89 residues), 63.5 bits, see alignment E=8.7e-21 PF08242: Methyltransf_12" amino acids 35 to 125 (91 residues), 60.7 bits, see alignment E=6.9e-20 PF08241: Methyltransf_11" amino acids 35 to 126 (92 residues), 57.3 bits, see alignment E=6.9e-19

Best Hits

Swiss-Prot: 52% identical to TAM_RHILO: Trans-aconitate 2-methyltransferase (tam) from Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)

KEGG orthology group: K00598, trans-aconitate 2-methyltransferase [EC: 2.1.1.144] (inferred from 90% identity to pfs:PFLU5494)

MetaCyc: 38% identical to malonyl-[acyl-carrier protein] O-methyltransferase (Mycobacterium tuberculosis H37Rv)
RXN-11475 [EC: 2.1.1.197]

Predicted SEED Role

"Trans-aconitate 2-methyltransferase (EC 2.1.1.144)" (EC 2.1.1.144)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.144 or 2.1.1.197

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U7E3 at UniProt or InterPro

Protein Sequence (253 amino acids)

>PS417_25365 trans-aconitate methyltransferase (Pseudomonas simiae WCS417)
MTWSAKQYTLFEQQRTRPVRDLVAAIPNAEVRNAVDLGCGPGNSTEVLAERFPQAHVTGL
DSSDDMLVDARKRLPALSFELADIGDWKPVQAFDVILANASLQWLPDHATLYPHLARQLT
PGGTLAVQTPDNLDEPAHRLARDVAADGPWSAKIGAVKHNQRHTASYYYELLSKHCSTVD
VWRTTYQHPLADHAAVVEWFKASALRPFLAPLTDGEKAAFLQEYQARITQAYPALADGTV
LLPFPRLFIIATR