Protein Info for PS417_25340 in Pseudomonas simiae WCS417

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 transmembrane" amino acids 13 to 30 (18 residues), see Phobius details amino acids 48 to 67 (20 residues), see Phobius details amino acids 84 to 106 (23 residues), see Phobius details amino acids 125 to 150 (26 residues), see Phobius details amino acids 162 to 183 (22 residues), see Phobius details amino acids 203 to 226 (24 residues), see Phobius details amino acids 234 to 265 (32 residues), see Phobius details amino acids 275 to 300 (26 residues), see Phobius details PF03706: LPG_synthase_TM" amino acids 19 to 293 (275 residues), 42.4 bits, see alignment E=3.1e-15

Best Hits

Swiss-Prot: 47% identical to YBHN_ECOLI: Inner membrane protein YbhN (ybhN) from Escherichia coli (strain K12)

KEGG orthology group: K07027, (no description) (inferred from 95% identity to pfs:PFLU5489)

Predicted SEED Role

"Inner membrane protein YbhQ"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U9S5 at UniProt or InterPro

Protein Sequence (315 amino acids)

>PS417_25340 membrane protein (Pseudomonas simiae WCS417)
MTTESRFKRWKKPLTIAFFLVLIVLFTLLARRIDWSEVVQTLGDFKVRTLVIAGALTLCS
FLVYASFDLIGRTYIRQNLVWKQILPVGIISYAFNLNLSAWVGGIAMRYRLYSRLGVSTS
NIAKILGLSLATNWFGYMAIAGVVFSSGLVTMPPGWKVSTTALQGIGALLVLASLGYLLA
CQFSKKRAWTIRGMEINLPSVRMACLQLMLGALNWSLMAAVIFTLLPAKLDYPLVLGVLL
ISAIAGVLTHIPAGLGVLEAVFIALLQHEASRGSLLAGLIAYRAIYFIVPLLIALVMYLG
VEAKAKALRVKKTPA