Protein Info for PS417_25325 in Pseudomonas simiae WCS417

Annotation: mechanosensitive ion channel protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 694 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 99 to 118 (20 residues), see Phobius details amino acids 137 to 159 (23 residues), see Phobius details amino acids 171 to 197 (27 residues), see Phobius details amino acids 217 to 235 (19 residues), see Phobius details amino acids 244 to 266 (23 residues), see Phobius details amino acids 298 to 316 (19 residues), see Phobius details amino acids 328 to 349 (22 residues), see Phobius details amino acids 370 to 391 (22 residues), see Phobius details amino acids 412 to 433 (22 residues), see Phobius details amino acids 458 to 478 (21 residues), see Phobius details amino acids 484 to 502 (19 residues), see Phobius details PF21088: MS_channel_1st" amino acids 463 to 503 (41 residues), 34 bits, see alignment 2.4e-12 PF00924: MS_channel_2nd" amino acids 505 to 570 (66 residues), 47.2 bits, see alignment E=1.9e-16

Best Hits

KEGG orthology group: None (inferred from 95% identity to pfs:PFLU5486)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7USG5 at UniProt or InterPro

Protein Sequence (694 amino acids)

>PS417_25325 mechanosensitive ion channel protein (Pseudomonas simiae WCS417)
MLNLKTALLLGALLFCGSGALQAAATAPEPEAPAKPELLVEGGLLGAISSSIDDVQQKLD
LNQNLIDEWRLRADRAADEVGRLVNQTAARSPWSVAGDFLLLSGVWCGAFVVLTLLGRFI
VQRLGRRTFFERRERLLAVLGYVIPYTIPALICLPLTLYVSHFLPTSIGRALALCFAYAT
SSGIFSTSMLLCVIVMFNVGHKRPAVRIIRSYCPKPLFLIGFLAALSDALTSPQIARQLG
GNITSSIAVFTGLFAAVIFGVLVVRLRRPVAHLIRNRPLAQRLKHPALQQSLRVFSGLWY
WPILLMVLVSGINLIGAGDDNQKTLRCALFTTILLIGTVFLSTVLRHLFKSRSQVAIQRS
SAYKERFLSLLHAILRIVMAIAFIEILGRIWGVSLFEFAQRNSVGRAISDSLSSIGLILL
MTWLFWVVLDTAIQEALKPPVNKRSSRQPSTRVKTILPLLRNAVKIILVVICAITTMANL
GINVAPLLAGAGVVGLAIGFGSQQLVQDVITGLFIIIEDTLSIGDWVVLDSGHAGTVEGL
TIRTLRLRDGKGFVHSVPFGQIKAVTNQSRQFAYAFFSVQFTYDTDVDKAVELIREAGQS
IRDDVFLKYNLQGPLEVFGVDKMDLNGVVLTAQFRTVSGGQYAVSRAFNQRLKKLVDNCG
EVHFAQTYPQQVLVPARTALEHEPTEAGAKIVNP