Protein Info for GFF494 in Variovorax sp. SCN45

Annotation: RND efflux system, membrane fusion protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 403 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 40 to 361 (322 residues), 237.8 bits, see alignment E=7.2e-75 PF25917: BSH_RND" amino acids 69 to 200 (132 residues), 37.1 bits, see alignment E=4.7e-13 PF25954: Beta-barrel_RND_2" amino acids 212 to 267 (56 residues), 27.4 bits, see alignment 6.4e-10 PF25967: RND-MFP_C" amino acids 294 to 349 (56 residues), 22.4 bits, see alignment 1.9e-08

Best Hits

KEGG orthology group: None (inferred from 89% identity to vpe:Varpa_3425)

Predicted SEED Role

"Probable Co/Zn/Cd efflux system membrane fusion protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (403 amino acids)

>GFF494 RND efflux system, membrane fusion protein (Variovorax sp. SCN45)
MTASTTVFSRARSAAWLLLPAVFLVGCSPKPAAQDPVRAVKFVTVGASEFDAQPEFSAEV
RARVESRLGFRVAGKITRRQAELGQHVQAGQVLAQLDPQDYRLAAEAARAQQAAALTNRD
LAAADLKRYRELREQNFISGAELERRETTWKAAQAQLEQAQAQLSSQGNQANYTTLVADV
AGIITAIEAEPGQVVQAGTPVVRIAQDGARDVVFAVPEDRATLVKTGSPVTVRGWSGGNE
LQGQVREVAASADAVTRTYSIKVAIDAATAPPLGATVYARPQALAHAGATVLKLPTSALR
QEGKGSAVWVLDKSTMTVRSQAVQVATADGNEAVIASGITPGMMVVAAGVHVLSPGQKVT
IYQSKEAAAAAANAGTKASVQPVAAVAATDKEIAAGATGGVAK