Protein Info for GFF4934 in Variovorax sp. SCN45

Annotation: ABC transporter, permease protein 2 (cluster 5, nickel/peptides/opines)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 transmembrane" amino acids 36 to 58 (23 residues), see Phobius details amino acids 101 to 126 (26 residues), see Phobius details amino acids 146 to 173 (28 residues), see Phobius details amino acids 224 to 244 (21 residues), see Phobius details amino acids 265 to 285 (21 residues), see Phobius details PF12911: OppC_N" amino acids 24 to 74 (51 residues), 49.3 bits, see alignment 3.5e-17 PF00528: BPD_transp_1" amino acids 115 to 296 (182 residues), 110.1 bits, see alignment E=1.1e-35

Best Hits

Swiss-Prot: 49% identical to DDPC_ECOLI: Probable D,D-dipeptide transport system permease protein DdpC (ddpC) from Escherichia coli (strain K12)

KEGG orthology group: K02034, peptide/nickel transport system permease protein (inferred from 63% identity to sit:TM1040_2716)

MetaCyc: 47% identical to dipeptide ABC transporter membrane subunit DppC (Escherichia coli K-12 substr. MG1655)
ABC-8-RXN [EC: 7.4.2.9]

Predicted SEED Role

"Dipeptide transport system permease protein DppC (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (298 amino acids)

>GFF4934 ABC transporter, permease protein 2 (cluster 5, nickel/peptides/opines) (Variovorax sp. SCN45)
MMLRQDWWLSEAPASAFQARCGRWYRMGLRTVRSPAMVFGLVILAAMVLAALFAPWLAPF
DPNAQNVQQRLLPPGAAHWLGTDQLGRDLLSRVIYGTRPTLLIVSLVALLSAPLGLLLGM
CAGYFGGWIDTLLMRVTDIFMAFPRLVLALALVAVLGPGIVNAVIAIAITAWPAYARIAR
TETRTVRGSDFIQAARVQGLRPARILFGHLLPICLPSTVVRVTLDMAGIILTAAGLGFLG
LGAQPPMSEWGAMISTGRQYIFDQWWVAAVPGVAILLGSLAFNLVGDGLRDVLDPKNG