Protein Info for GFF4932 in Sphingobium sp. HT1-2

Annotation: 3-alpha-hydroxysteroid dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00106: adh_short
  • amino acids 10 to 125 (116 residues), 46.6 bits, E=4.5e-16
• PF01370: Epimerase
  • amino acids 13 to 107 (95 residues), 26.7 bits, E=5.4e-10
• PF13561: adh_short_C2
  • amino acids 18 to 254 (237 residues), 80.3 bits, E=2.6e-26

Best Hits

KEGG orthology group: K00037, 3-alpha-hydroxysteroid dehydrogenase [EC: 1.1.1.50] (inferred from 51% identity to sal:Sala_0895)

Predicted SEED Role

No annotation

MetaCyc Pathways

• testosterone and androsterone degradation to androstendione (aerobic) (1/3 steps found)
• superpathway of testosterone and androsterone degradation (7/28 steps found)

KEGG Metabolic Maps

• Androgen and estrogen metabolism
• Bile acid biosynthesis
• C21-Steroid hormone metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.50

Protein Sequence (277 amino acids)

>GFF4932 3-alpha-hydroxysteroid dehydrogenase (Sphingobium sp. HT1-2)
MSDILGYKGKRVIVSGCFSGMGEATAKLLLELGAEVHGLDFRDSSQPLASFTNVDLRDPA
SIEAAVAGIGGKVDALFNCAGLPQSFPPLDVMKVNFIGLRHLTEQVLPLMGPGGAIASIA
STGGLGWSRRIPTNMEFVTTKGYDAAVVWCEAHLDDVVKEGYSFSKENVIVWTQYMGAHL
IKKGIRINCTLPSPTQTPMMATFEAASGKDVVAAAAEPMGRYSTPAEQAGGIVLLNSDLA
GIVNGVVFPVDGGFMGGVATGQVDLSVMMRRSAPAEA