Protein Info for PS417_25230 in Pseudomonas simiae WCS417

Annotation: GTP cyclohydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00505: GTP cyclohydrolase II
  • amino acids 7 to 194 (188 residues), 260.9 bits, E=2.9e-82
• PF00925: GTP_cyclohydro2
  • amino acids 8 to 170 (163 residues), 224.9 bits, E=2.2e-71

Best Hits

Swiss-Prot: 98% identical to RIBA_PSEFS: GTP cyclohydrolase-2 (ribA) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K01497, GTP cyclohydrolase II [EC: 3.5.4.25] (inferred from 98% identity to pfs:PFLU5466)

MetaCyc: 65% identical to GTP cyclohydrolase 2 (Escherichia coli K-12 substr. MG1655)
GTP cyclohydrolase II. [EC: 3.5.4.25]

Predicted SEED Role

"GTP cyclohydrolase II (EC 3.5.4.25)" in subsystem Molybdenum cofactor biosynthesis or Riboflavin, FMN and FAD metabolism (EC 3.5.4.25)

MetaCyc Pathways

• flavin biosynthesis I (bacteria and plants) (8/9 steps found)
• flavin biosynthesis III (fungi) (7/9 steps found)
• 6-hydroxymethyl-dihydropterin diphosphate biosynthesis III (Chlamydia) (3/5 steps found)
• toxoflavin biosynthesis (3/7 steps found)
• flavin biosynthesis II (archaea) (5/10 steps found)

KEGG Metabolic Maps

• Riboflavin metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.5.4.25

Use Curated BLAST to search for 3.5.4.25

Sequence Analysis Tools

See A0A1N7U1Z5 at UniProt or InterPro

Protein Sequence (205 amino acids)

>PS417_25230 GTP cyclohydrolase (Pseudomonas simiae WCS417)
MPVVFVAASKLPTPFATFTINGFLEDATGREHVVLSLGDIADGAPVLGRVHSECLTGDAL
FSQRCDCGSQLEAAMRAIAREGRGVLLYLRQEGRGIGLMNKIRAYELQDGGADTVEANER
LGFAADQRDYAICLPMLEHLGVKSLRLMTNNPRKVKALTEMGITVAERVPLHTGHNPHNK
LYLATKASKLDHMMGNEHQGEVDRA