Protein Info for PS417_25205 in Pseudomonas simiae WCS417

Annotation: 1-deoxy-D-xylulose-5-phosphate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13292: DXP_synthase_N
  • amino acids 18 to 289 (272 residues), 398.4 bits, E=4e-123
• TIGR00204: 1-deoxy-D-xylulose-5-phosphate synthase
  • amino acids 23 to 627 (605 residues), 875.9 bits, E=8e-268
• PF02775: TPP_enzyme_C
  • amino acids 128 to 190 (63 residues), 23.9 bits, E=8.2e-09
• PF00676: E1_dh
  • amino acids 130 to 193 (64 residues), 26.5 bits, E=7.7e-10
• PF02779: Transket_pyr
  • amino acids 328 to 488 (161 residues), 152.7 bits, E=2e-48
• PF02780: Transketolase_C
  • amino acids 503 to 619 (117 residues), 94.3 bits, E=1.4e-30

Best Hits

Swiss-Prot: 99% identical to DXS_PSEFS: 1-deoxy-D-xylulose-5-phosphate synthase (dxs) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K01662, 1-deoxy-D-xylulose-5-phosphate synthase [EC: 2.2.1.7] (inferred from 99% identity to pfs:PFLU5462)

MetaCyc: 63% identical to 1-deoxy-D-xylulose-5-phosphate synthase (Escherichia coli K-12 substr. MG1655)
1-deoxy-D-xylulose-5-phosphate synthase. [EC: 2.2.1.7]

Predicted SEED Role

"1-deoxy-D-xylulose 5-phosphate synthase (EC 2.2.1.7)" in subsystem Isoprenoid Biosynthesis or Pyridoxin (Vitamin B6) Biosynthesis or Thiamin biosynthesis (EC 2.2.1.7)

MetaCyc Pathways

• superpathway of geranylgeranyl diphosphate biosynthesis II (via MEP) (11/12 steps found)
• superpathway of pyridoxal 5'-phosphate biosynthesis and salvage (11/12 steps found)
• pyridoxal 5'-phosphate biosynthesis I (7/7 steps found)
• taxadiene biosynthesis (engineered) (11/13 steps found)
• methylerythritol phosphate pathway I (8/9 steps found)
• methylerythritol phosphate pathway II (8/9 steps found)
• superpathway of thiamine diphosphate biosynthesis II (9/11 steps found)
• isoprene biosynthesis I (8/10 steps found)
• superpathway of thiamine diphosphate biosynthesis I (8/10 steps found)
• thiazole component of thiamine diphosphate biosynthesis II (5/7 steps found)
• thiazole component of thiamine diphosphate biosynthesis I (4/6 steps found)
• superpathway of ergosterol biosynthesis II (10/26 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Terpenoid biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.2.1.7

Sequence Analysis Tools

See A0A1N7U4E9 at UniProt or InterPro

Protein Sequence (632 amino acids)

>PS417_25205 1-deoxy-D-xylulose-5-phosphate synthase (Pseudomonas simiae WCS417)
MPTTFQEIPRKRPSTPLLDRAVTPAGLRRLGEAELETLADELRLELLYTVGQTGGHFGAG
LGVIELTIALHYVFDTPDDRLVWDVGHQAYPHKILTGRRERMGSLRQKDGIAAFPRRAES
EYDTFGVGHSSTSISAALGMAIAARLQGSDRKAIAVIGDGALTAGMAFEALNHAPEVDAN
MLVILNDNDMSISRNVGGLSNYLAKILSSRTYASMREGSKKVLSRLPGAWEIARRTEEYA
KGMLVPGTLFEELGWNYIGPIDGHDLPTLIATLRNMRDLKGPQFLHIVTKKGKGFAPAEV
DPIGYHAITKLEPVDAPAAAPKKASGPKYSGVFGEWLCDMAAADPRLVGITPAMKEGSDL
VAFSERFPLRYFDVAIAEQHAVTFAAGMACEGAKPVVAIYSTFLQRGYDQLVHDVAVQNL
DVLFAIDRAGLVGEDGPTHAGSFDLSYLRCIPGMLVMTPSDENELRKMLSTGHLYNGPAA
VRYPRGNGPNAVIEKDLEPIEIGKGIVRRQGSKTAFLVFGVQLAEALKVAEKIDATVVDM
RFVKPLDEALVREIAGSHELLVTVEENAIMGGAGAAVSEFLARENILKSVLHLGLPDVYV
EHAKPAQMLAECGLDEAGIEASVRERMALLGL