Protein Info for GFF4907 in Sphingobium sp. HT1-2

Annotation: Oxidoreductase, short-chain dehydrogenase/reductase family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 270 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF00106: adh_short" amino acids 8 to 191 (184 residues), 154.5 bits, see alignment E=4.9e-49 PF08659: KR" amino acids 11 to 172 (162 residues), 29.5 bits, see alignment E=1.3e-10 PF13561: adh_short_C2" amino acids 14 to 190 (177 residues), 108.1 bits, see alignment E=1.1e-34 amino acids 220 to 267 (48 residues), 35.1 bits, see alignment 2.3e-12

Best Hits

KEGG orthology group: None (inferred from 53% identity to fre:Franean1_3842)

Predicted SEED Role

"3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100)" in subsystem Fatty Acid Biosynthesis FASII or mycolic acid synthesis (EC 1.1.1.100)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.100

Use Curated BLAST to search for 1.1.1.100

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (270 amino acids)

>GFF4907 Oxidoreductase, short-chain dehydrogenase/reductase family (Sphingobium sp. HT1-2)
MDMQMTGRVAIVTGATANIGRAISLGLAAEGVKLVAVGRDQAAGARLVEQAIATGAQDAR
FVAADLSDPAAPGQILAAASALGEVAILVNNVGGNIGAGFFVDSDPASWAGDIDLNLGTL
LRMTHATLPGMIARKAGAIVNIGSTAGIVGDYMLPVYSAAKAAVHGFTKVLAKEVGPHGI
RVNCVAPYGTVSRDPAAFSSGSRFHPDRNFFGRAFASTSPKDMEKRSRQTVLGRPVAFAE
EVASLAVYLASDQAGFITGQVYPVDGGSLL