Protein Info for GFF4907 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Outer membrane protein assembly factor YaeT precursor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 786 signal peptide" amino acids 1 to 41 (41 residues), see Phobius details TIGR03303: outer membrane protein assembly complex, YaeT protein" amino acids 44 to 786 (743 residues), 845.6 bits, see alignment E=1.9e-258 PF07244: POTRA" amino acids 112 to 192 (81 residues), 47.5 bits, see alignment E=2.4e-16 amino acids 196 to 283 (88 residues), 65.3 bits, see alignment E=6.9e-22 amino acids 286 to 357 (72 residues), 30.9 bits, see alignment E=3.7e-11 amino acids 367 to 441 (75 residues), 51.6 bits, see alignment E=1.3e-17 PF01103: Omp85" amino acids 468 to 786 (319 residues), 271.8 bits, see alignment E=1.1e-84

Best Hits

KEGG orthology group: K07277, outer membrane protein (inferred from 70% identity to adn:Alide_1472)

Predicted SEED Role

"Outer membrane protein assembly factor YaeT precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (786 amino acids)

>GFF4907 Outer membrane protein assembly factor YaeT precursor (Hydrogenophaga sp. GW460-11-11-14-LB1)
MWPAWLAERFFSMKTKSFGLRGLTFSALATALLSALPAWAVDPFTLRDIRVEGLQRVEPG
TVFASLPFRIGDQYNDDKGSTAIRSLFGLGLFSDVRLQVNGDVLVVIVEERPTVADVSFS
GIKEFDEAVLKKALRDIGLTEGRPFDKALADRAEQELKRQYINRSMYASQVVTTVTPGER
NRVNLNFNVIEGDVAKIREIRIVGNKAFSESTLRNLFDLDTGGWLSWYTKSDRYARAKLN
ADIETLRSYYLTRGYLEFRVDSTQVAISPDKESMSITLNITEGDRYVVKSVALEGEYLGR
EEEFKSLVTLRAGEAYNAEDESSTVKAFTDYFGAFGYAFAQVEATRDIDRVNKQVAFVLR
AQPARRVYVRRINVEGNNRTRDEVIRREFRQLESAWYDSDRIRLSRDRVDRLGFFTSVEV
DTQPVPGTPDQVDMTITVAEKPTGNLTLGAGYSQADKLSIIAGIRQENVFGSGNYLGVDV
NTSDYNRQIVVSTVDPYFTPDGVSRSFDAYYRTTTPYTEQGGDYRLVTPGVSVKFGVPFT
EQDTVFFGIGVEQTKIEPGTGLPQAYQLYSNTFGESSTSVPLTIGWSRDGRDSALVPTQG
RLQRFNTELGVGGDTRYLKASYQIQQYIPLSKQYTLAFNGELGYGKGLGGRPFPLFKNFY
GGGLGSVRGFDQGTLGPTSPIMSGAQAGQLVNIGGNRSMALSAEFITPFPGAGNDRTLRM
FGFIDVGNVYGENDTRPNATDLRASVGVGLSWISPVGPLRFAIANPIRKFTGDRIQKFQF
QIGTSF