Protein Info for GFF4905 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase (EC 2.3.1.191)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 TIGR01853: UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase LpxD" amino acids 7 to 332 (326 residues), 355.5 bits, see alignment E=1.2e-110 PF04613: LpxD" amino acids 21 to 90 (70 residues), 74.3 bits, see alignment E=1.1e-24 PF25087: GMPPB_C" amino acids 107 to 184 (78 residues), 37.8 bits, see alignment E=2.9e-13 PF14602: Hexapep_2" amino acids 161 to 183 (23 residues), 13.5 bits, see alignment (E = 9.7e-06) amino acids 204 to 235 (32 residues), 12.1 bits, see alignment (E = 2.8e-05) amino acids 263 to 296 (34 residues), 13.3 bits, see alignment 1.1e-05

Best Hits

Swiss-Prot: 64% identical to LPXD_POLNA: UDP-3-O-acylglucosamine N-acyltransferase (lpxD) from Polaromonas naphthalenivorans (strain CJ2)

KEGG orthology group: K02536, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [EC: 2.3.1.-] (inferred from 64% identity to pna:Pnap_1768)

Predicted SEED Role

"UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase (EC 2.3.1.191)" (EC 2.3.1.191)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.- or 2.3.1.191

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (350 amino acids)

>GFF4905 UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase (EC 2.3.1.191) (Hydrogenophaga sp. GW460-11-11-14-LB1)
VSRPLGDIVEALGGTRHGAPDLLIHRLAPVATAGPGELAFVAQARYASQIDTTAAGVLLV
PPALLDRALARGACIVSDDPYLYFAKLTQWWRRQHEAAPAPGVDPLASIHPSAQVDEGAS
VGPFAVVGRDVHLARGARIGAHAVLGDGAKVGEGTVLHPRVTLGERCVIGARGVVHSGAV
IGADGFGFAPHQGEWIKIEQLGAVRIGDDVEIGANTCIDRGALDDTVIEDGVKLDNLIQI
GHNVHVGAHTAMAGCVGVAGSATIGAHCTIGGGAVVLGHLRLADGVHVSAASVVTRSLLK
PGHYTGMFPIDDNANWEKNAASLKQLNRLRERLKAAEQAIEQALQNNSKP