Protein Info for GFF4903 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosamine O-acyltransferase (EC 2.3.1.129)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 264 TIGR01852: acyl-[acyl-carrier-protein]-UDP-N-acetylglucosamine O-acyltransferase" amino acids 4 to 262 (259 residues), 311.6 bits, see alignment E=1.7e-97 PF00132: Hexapep" amino acids 19 to 48 (30 residues), 29.9 bits, see alignment (E = 3.3e-11) amino acids 105 to 138 (34 residues), 36.8 bits, see alignment 2.1e-13 PF13720: Acetyltransf_11" amino acids 176 to 263 (88 residues), 79.9 bits, see alignment E=1.5e-26

Best Hits

Swiss-Prot: 79% identical to LPXA_RHOFT: Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase (lpxA) from Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)

KEGG orthology group: K00677, UDP-N-acetylglucosamine acyltransferase [EC: 2.3.1.129] (inferred from 87% identity to pol:Bpro_2683)

MetaCyc: 50% identical to acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase (Escherichia coli K-12 substr. MG1655)
Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase. [EC: 2.3.1.129]

Predicted SEED Role

"Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase (EC 2.3.1.129)" in subsystem KDO2-Lipid A biosynthesis (EC 2.3.1.129)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.129

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (264 amino acids)

>GFF4903 Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosamine O-acyltransferase (EC 2.3.1.129) (Hydrogenophaga sp. GW460-11-11-14-LB1)
VSLIHPTALVDPAAELDSSVAVGPYTVIGPHVKIGAGTTVGAHCVIEGHTTIGRDNRIFQ
FNSLGAVPQDKKYAGEPCELVIGDRNTIREFCTFNIGSPGDRAVTQVGNDNWIMAYVHLA
HDCVVGNHTIFANNSQLAGHVVVDDWVILGGFTVVHQFVRVGAHAMTAMCSLLFADLPPF
VMCQGQPAQARSMNFEGLRRRGFSAERISAVKAMHKALYRDDLKLDEAVVRIRGLTDKTP
EAAPDVAMMLDFLGQVSPQRGIVR