Protein Info for GFF4900 in Xanthobacter sp. DMC5

Annotation: putative chromate transport protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 417 transmembrane" amino acids 23 to 44 (22 residues), see Phobius details amino acids 77 to 86 (10 residues), see Phobius details amino acids 91 to 120 (30 residues), see Phobius details amino acids 128 to 147 (20 residues), see Phobius details amino acids 159 to 190 (32 residues), see Phobius details amino acids 218 to 238 (21 residues), see Phobius details amino acids 249 to 271 (23 residues), see Phobius details amino acids 283 to 306 (24 residues), see Phobius details amino acids 314 to 338 (25 residues), see Phobius details amino acids 351 to 416 (66 residues), see Phobius details PF02417: Chromate_transp" amino acids 22 to 188 (167 residues), 130.9 bits, see alignment E=2.3e-42 amino acids 244 to 410 (167 residues), 127.6 bits, see alignment E=2.5e-41 TIGR00937: chromate efflux transporter" amino acids 27 to 410 (384 residues), 314.4 bits, see alignment E=7.5e-98

Best Hits

KEGG orthology group: K07240, chromate transporter (inferred from 78% identity to xau:Xaut_1773)

Predicted SEED Role

"Chromate transport protein ChrA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (417 amino acids)

>GFF4900 putative chromate transport protein (Xanthobacter sp. DMC5)
MSRDDVADAAIPAAPTMGTPLEVLVAFLKLGLTSFGGPIAHLGYFRDELVLRRRWLDDEA
YADLVALCQFLPGPASSQLGFALGLIRGGGLLGGIAAWAGFTLPSAVALVAVALGAAALG
GPAAEGVLHGLKLVAVAVVAQAVWGMVRTLTPDRPRAGIALASVALVVFAGGAFGQIAAI
AVGALAGLALCREENTARRSGGGNSHAPPVPLSRRTGMLLLAAFATLLVVPPILAPAIGS
QGLALFDAFYRSGALVFGGGHVVLPLLQAEMVATGWVSPDDFLAGYGLVQAVPGPLFTFA
AWLGAVMRPEPNGIAGAAIALVAVFLPGILLVTGMLPFWDTLRRKMLAQAAMRGANAAVV
GILGAALYSPVFTGAIFSPVDFVLALAGFLLLTVWRLPPLVVVLVLAAVGGLPPVLL