Protein Info for GFF490 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Cellulose synthase catalytic subunit [UDP-forming] (EC 2.4.1.12)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 874 signal peptide" amino acids 1 to 16 (16 residues), see Phobius details transmembrane" amino acids 31 to 50 (20 residues), see Phobius details amino acids 150 to 167 (18 residues), see Phobius details amino acids 173 to 190 (18 residues), see Phobius details amino acids 197 to 216 (20 residues), see Phobius details amino acids 228 to 252 (25 residues), see Phobius details amino acids 523 to 547 (25 residues), see Phobius details amino acids 553 to 573 (21 residues), see Phobius details amino acids 639 to 659 (21 residues), see Phobius details amino acids 665 to 690 (26 residues), see Phobius details amino acids 836 to 853 (18 residues), see Phobius details TIGR03030: cellulose synthase catalytic subunit (UDP-forming)" amino acids 147 to 830 (684 residues), 1014.6 bits, see alignment E=0 PF13641: Glyco_tranf_2_3" amino acids 273 to 500 (228 residues), 65.3 bits, see alignment E=2.1e-21 PF00535: Glycos_transf_2" amino acids 277 to 447 (171 residues), 83.9 bits, see alignment E=3.8e-27 PF13506: Glyco_transf_21" amino acids 339 to 561 (223 residues), 36.4 bits, see alignment E=8.5e-13 PF13632: Glyco_trans_2_3" amino acids 356 to 565 (210 residues), 67.8 bits, see alignment E=3.6e-22 PF03552: Cellulose_synt" amino acids 446 to 664 (219 residues), 46.8 bits, see alignment E=5.2e-16 PF07238: PilZ" amino acids 694 to 790 (97 residues), 55.3 bits, see alignment E=2.2e-18

Best Hits

Swiss-Prot: 100% identical to BCSA_SALTY: Cellulose synthase catalytic subunit [UDP-forming] (bcsA) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K00694, cellulose synthase (UDP-forming) [EC: 2.4.1.12] (inferred from 92% identity to cko:CKO_04977)

MetaCyc: 88% identical to cellulose synthase catalytic subunit (Escherichia coli K-12 substr. MG1655)
Cellulose synthase (UDP-forming). [EC: 2.4.1.12]

Predicted SEED Role

"Cellulose synthase catalytic subunit [UDP-forming] (EC 2.4.1.12)" (EC 2.4.1.12)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.1.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (874 amino acids)

>GFF490 Cellulose synthase catalytic subunit [UDP-forming] (EC 2.4.1.12) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MSALSRWLLIPPVSARLSERYQGYRRHGASPFSAALGCLWTILAWIVFPLEHPRWQRIRD
GHKALYPHINAARPRPLDPARYLIQTLWLVMISSTKERHEPRWRSFARLKDVRGRYHQWM
DTLPERVRQKTTHLEKEKELGHLSNGARRFILGVIVTFSLILALICITQPFNPLSQFIFL
LLLWGVALLVRRMPGRFSALMLIVLSLTVSCRYIWWRYTSTLNWDDPVSLVCGLILLFAE
TYAWIVLVLGYFQVVWPLNRQPVPLPKEMSQWPTVDIFVPTYNEDLNVVKNTIYASLGID
WPKDKLNIWILDDGGRESFRHFARHVGVHYIARTTHEHAKAGNINNALKHAKGEFVAIFD
CDHVPTRSFLQMTMGWFLKEKQLAMMQTPHHFFSPDPFERNLGRFRKTPNEGTLFYGLVQ
DGNDMWDATFFCGSCAVIRRKPLDEIGGIAVETVTEDAHTSLRLHRRGYTSAYMRIPQAA
GLATESLSAHIGQRIRWARGMVQIFRLDNPLFGKGLKLAQRLCYLNAMFHFLSGIPRLIF
LTAPLAFLLLHAYIIYAPALMIALFVIPHMVHASLTNSKIQGKYRHSFWSEIYETVLAWY
IAPPTLVALINPHKGKFNVTAKGGLVEEKYVDWVISRPYIFLVLLNLLGVAAGVWRYYYG
PENETLTVIVSLVWVFYNLVILGGAVAVSVESKQVRRAHRVEIAMPGAIAREDGHLFSCT
VHDFSDGGLGIKINGQAQVLEGQKVNLLLKRGQQEYVFPTQVVRVTGNEVGLQLMPLTTK
QHIDFVQCTFARADTWALWQDSFPEDKPLESLLDILKLGFRGYRHLAEFAPPSVKVIFRS
LTALIAWIVSFIPRRPERQAAIQPSDRVMAQAQQ