Protein Info for GFF4899 in Xanthobacter sp. DMC5

Annotation: Transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 108 PF03551: PadR" amino acids 15 to 84 (70 residues), 62.8 bits, see alignment E=1.3e-21

Best Hits

Swiss-Prot: 55% identical to CDDTR_MYCTU: Transcriptional regulator Rv3488 (Rv3488) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: None (inferred from 69% identity to mno:Mnod_3107)

Predicted SEED Role

"Transcriptional regulator, PadR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (108 amino acids)

>GFF4899 Transcriptional regulator (Xanthobacter sp. DMC5)
MEHQELLSGLVRLHILHHAAEGEVYGQWMMEELARHGYRLSPGTLYPMLHAMERKGYLAV
REERHGRVLRRLYHATPLGREALETARQKVRELFKEMRPDPSTETTTP