Protein Info for GFF4896 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Probable transmembrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 149 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details transmembrane" amino acids 46 to 65 (20 residues), see Phobius details amino acids 77 to 96 (20 residues), see Phobius details amino acids 116 to 139 (24 residues), see Phobius details PF13664: DUF4149" amino acids 10 to 111 (102 residues), 55.9 bits, see alignment E=2.2e-19

Best Hits

KEGG orthology group: None (inferred from 45% identity to vpe:Varpa_3307)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (149 amino acids)

>GFF4896 Probable transmembrane protein (Hydrogenophaga sp. GW460-11-11-14-LB1)
MPLHRVAIFVAALWWGGITALSFLAVPTLFAQLGSPAVAGPVAAKLFSLQCHAGLLLGLA
LLVMLRRGNEQGGRPDGATMTTLGIVVLGMLLALLQEFGVAQNIVTARASGGNLRLWHGV
GSAMVLGQWLCAGLVLWRLSKDSKARLER