Protein Info for PS417_25075 in Pseudomonas simiae WCS417

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 188 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details PF14602: Hexapep_2" amino acids 78 to 92 (15 residues), 16.3 bits, see alignment (E = 6.6e-07) amino acids 124 to 159 (36 residues), 37.8 bits, see alignment 1.3e-13 PF00132: Hexapep" amino acids 125 to 159 (35 residues), 39.8 bits, see alignment 2.4e-14

Best Hits

Swiss-Prot: 39% identical to WBBJ_ECOLI: Putative lipopolysaccharide biosynthesis O-acetyl transferase WbbJ (wbbJ) from Escherichia coli (strain K12)

KEGG orthology group: K08280, lipopolysaccharide O-acetyltransferase [EC: 2.3.1.-] (inferred from 39% identity to ecd:ECDH10B_2183)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UI51 at UniProt or InterPro

Protein Sequence (188 amino acids)

>PS417_25075 hypothetical protein (Pseudomonas simiae WCS417)
MWIRLAFFSVLSKLLYGMNVRVIKGFARVINKGHLQFGSRFTAGVDLRIEVLEDSACVTF
GQNVKINDYCHIGAMSRVVVGDDCLIGSRVTIVDHEHGVYRKPSDHPASLPWTPPDERLL
QGKPIIIEKNVWIGSGAIIVGGVTIGEGSVIGANAVVTRDISRYSLAVGAPAKVIKTFDE
GGKQWLCV