Protein Info for GFF4879 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: transcriptional regulator SoxR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 124 PF12840: HTH_20" amino acids 27 to 75 (49 residues), 43.1 bits, see alignment E=3.3e-15 PF01022: HTH_5" amino acids 30 to 73 (44 residues), 47.5 bits, see alignment E=1.3e-16

Best Hits

KEGG orthology group: K03892, ArsR family transcriptional regulator (inferred from 79% identity to pol:Bpro_2632)

Predicted SEED Role

"transcriptional regulator SoxR" in subsystem Sulfur oxidation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (124 amino acids)

>GFF4879 transcriptional regulator SoxR (Hydrogenophaga sp. GW460-11-11-14-LB1)
MEQMIASEGQVEKVRVFELAAELFGVLATPMRLRILSALCDKEKSVSQLLQEIDTTQPNL
SQHLNLLYRAGVLAKRKDGTQVIYRVQSEKAVTLCRTVCTQIAIEMDEPSSVPASERLSP
RASS