Protein Info for GFF4876 in Variovorax sp. SCN45

Annotation: FIG00973848: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 249 transmembrane" amino acids 14 to 32 (19 residues), see Phobius details PF20109: Trans_reg_dom" amino acids 10 to 58 (49 residues), 26.3 bits, see alignment 1.2e-09 PF22791: DUF7011" amino acids 80 to 126 (47 residues), 86.8 bits, see alignment 7e-29 PF10074: RovC_DNA-bd" amino acids 150 to 233 (84 residues), 82.9 bits, see alignment E=3.7e-27

Best Hits

KEGG orthology group: None (inferred from 100% identity to rpi:Rpic_2618)

Predicted SEED Role

"FIG00973848: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (249 amino acids)

>GFF4876 FIG00973848: hypothetical protein (Variovorax sp. SCN45)
MAEPHHLAHWYPTAAYLYVLCLDTLALAWEYLRRHPDYRLDWLHRARRLDAAHRWGLRLL
EDPALDARDAHPAWLPGHEAVVQLHPDADPPPDAAAFAFWCIPGHKQLLHDGKGLALIAR
SSGHCLRYALAPGLEDGMAVAYAHRGHGTTHVPDTPAPMARPRPPPAALLELHTLQALDA
TLAGASLRDVAEGLFGADAAAGWYSDGGLRSKVRRLVRRGDALMRGGYRRLAQLPPLEKG
RFEESAKRP