Protein Info for GFF4869 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: FIG00761799: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 304 transmembrane" amino acids 7 to 27 (21 residues), see Phobius details amino acids 35 to 56 (22 residues), see Phobius details amino acids 72 to 92 (21 residues), see Phobius details amino acids 101 to 120 (20 residues), see Phobius details amino acids 126 to 144 (19 residues), see Phobius details amino acids 150 to 166 (17 residues), see Phobius details amino acids 178 to 196 (19 residues), see Phobius details amino acids 208 to 228 (21 residues), see Phobius details amino acids 235 to 256 (22 residues), see Phobius details amino acids 262 to 284 (23 residues), see Phobius details PF00892: EamA" amino acids 7 to 141 (135 residues), 44.6 bits, see alignment E=9.3e-16 TIGR00688: protein RarD" amino acids 8 to 255 (248 residues), 158.1 bits, see alignment E=1.4e-50

Best Hits

Swiss-Prot: 35% identical to Y485_PSEAE: Uncharacterized transporter PA0485 (PA0485) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 98% identity to seg:SG2896)

Predicted SEED Role

"FIG00761799: membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (304 amino acids)

>GFF4869 FIG00761799: membrane protein (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
VEKYLRSGTMFVVLAFILWGLTPLYYQYLSGGNLAQILIYRVFWSIPLLLAVRLLFRQRT
RFHDAWKDKKSFFFCMIAGLLMIVSWSSFIYALTHHLVLDASLGYFINPLFVIALGCIFL
KEKLSLFQAIAVFSGVCGLTFQIIMLRHFPALALTMGLSFALYGLARKFIHYDVMTSITI
ETLWALPVSLLIFLFSDTGPIISANTPFFLYVMTAPVTIIPLVLFAIALNHTSLIVTGLA
QYIEPSLQFLLAIMIFGEHINYAELLCFCAVWFGLFLCISENLYSHYLRARLKPVFGRVQ
RFFR