Protein Info for PS417_24845 in Pseudomonas simiae WCS417

Annotation: inorganic pyrophosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 175 PF00719: Pyrophosphatase" amino acids 18 to 174 (157 residues), 199.9 bits, see alignment E=1.1e-63

Best Hits

Swiss-Prot: 96% identical to IPYR1_PSESM: Inorganic pyrophosphatase 1 (ppa1) from Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)

KEGG orthology group: K01507, inorganic pyrophosphatase [EC: 3.6.1.1] (inferred from 100% identity to pfs:PFLU5448)

MetaCyc: 69% identical to inorganic pyrophosphatase (Escherichia coli K-12 substr. MG1655)
Triphosphatase. [EC: 3.6.1.25]; Inorganic diphosphatase. [EC: 3.6.1.25, 3.6.1.1]

Predicted SEED Role

"Inorganic pyrophosphatase (EC 3.6.1.1)" in subsystem Phosphate metabolism (EC 3.6.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.1 or 3.6.1.25

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UCP2 at UniProt or InterPro

Protein Sequence (175 amino acids)

>PS417_24845 inorganic pyrophosphatase (Pseudomonas simiae WCS417)
MSYSKIPAGKDLPNDIYVAIEIPANHAPIKYEIDKDSDCLFVDRFMATPMFYPANYGFIP
NTLADDGDPLDVLVVTPYPVTPGSVIRARPVGILNMTDDGGGDAKVIAVPHDKLSQLYVD
VKEYTDLPPLLLEQIKHFFENYKDLEKGKWVKIDGWGNADAARAEILKSVAAYKG