Protein Info for PS417_24775 in Pseudomonas simiae WCS417

Annotation: dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 151 PF01575: MaoC_dehydratas" amino acids 13 to 119 (107 residues), 96.9 bits, see alignment E=6.6e-32 PF13452: FAS1_DH_region" amino acids 13 to 124 (112 residues), 25.5 bits, see alignment E=1.3e-09

Best Hits

Swiss-Prot: 49% identical to ECH1_MYCTU: Probable enoyl-CoA hydratase 1 (Rv0130) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: None (inferred from 97% identity to pfs:PFLU5434)

MetaCyc: 45% identical to 4-chloro-3-hydroxybutyryl-CoA dehydratase (Salinispora tropica)
4.2.1.-

Predicted SEED Role

"MaoC-like domain protein"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U9H7 at UniProt or InterPro

Protein Sequence (151 amino acids)

>PS417_24775 dehydratase (Pseudomonas simiae WCS417)
MPYVPVAQLKDYVGKELGRSEWLTIDQARINLFAEATGDHQFIHVDPVKAAQTPFGSTIA
HGFLSLSLMPKLMEDLLIVPEGLKMAVNYGLDSVRFIQPVKVNSKVRLNVTLNDVTEKKP
GQWLLKATATLEIEGQEKPAYIAESLSLYFV