Protein Info for PS417_24750 in Pseudomonas simiae WCS417

Annotation: 3-methyladenine DNA glycosylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 227 PF02245: Pur_DNA_glyco" amino acids 16 to 204 (189 residues), 127.7 bits, see alignment E=1.7e-41

Best Hits

Swiss-Prot: 85% identical to 3MGH_PSEPF: Putative 3-methyladenine DNA glycosylase (Pfl01_4975) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K03652, DNA-3-methyladenine glycosylase [EC: 3.2.2.21] (inferred from 95% identity to pfs:PFLU5428)

Predicted SEED Role

"DNA-3-methyladenine glycosylase II (EC 3.2.2.21)" in subsystem DNA Repair Base Excision (EC 3.2.2.21)

Isozymes

Compare fitness of predicted isozymes for: 3.2.2.21

Use Curated BLAST to search for 3.2.2.21

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U743 at UniProt or InterPro

Protein Sequence (227 amino acids)

>PS417_24750 3-methyladenine DNA glycosylase (Pseudomonas simiae WCS417)
MPSSSPQLPASALPDSFFDRDAQILAQALLGKVIRHRVGETWLSARIIETEAYYVAEKGS
HASLGYTEKRKALFLDGGHIYMYYARGGDSLNFSAHGPGNAVLIKSAYPWVDELSGPASL
AQMLLNNPNADGSPRTLQKLCAGQTLLCKALGLKVPMWDAKRFDQEQLYVEDVGQTPIQI
IQTTRLGIPSGRDEHLMYRFVDAGYAPYCTRNPLRRGQVEDRDYFLI