Protein Info for GFF4838 in Sphingobium sp. HT1-2

Annotation: Intracellular protease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01965: DJ-1_PfpI
  • amino acids 6 to 176 (171 residues), 173.2 bits, E=2.1e-55
• TIGR01382: intracellular protease, PfpI family
  • amino acids 10 to 176 (167 residues), 161.9 bits, E=5.3e-52

Best Hits

Swiss-Prot: 44% identical to GS18_BACSU: General stress protein 18 (yfkM) from Bacillus subtilis (strain 168)

KEGG orthology group: K05520, protease I [EC: 3.2.-.-] (inferred from 66% identity to tra:Trad_2251)

MetaCyc: 46% identical to protein/nucleic acid deglycase 2 (Escherichia coli K-12 substr. MG1655)
GLYOXIII-RXN [EC: 4.2.1.130]; RXN-17632 [EC: 4.2.1.130, 3.5.1.124]

Predicted SEED Role

"ThiJ/PfpI family protein"

MetaCyc Pathways

• methylglyoxal degradation IX (1/1 steps found)

KEGG Metabolic Maps

• Glycosaminoglycan degradation

Isozymes

Compare fitness of predicted isozymes for: 3.2.-.-

Use Curated BLAST to search for 3.2.-.- or 3.5.1.124 or 4.2.1.130

Protein Sequence (189 amino acids)

>GFF4838 Intracellular protease (Sphingobium sp. HT1-2)
MTLEGKSIAILIAPRGTEEPEFSKPKQAVEDAGGKVTVVSFEPGKARTVNGDLDEGASYT
IDKTFSEVKADDFDGLVVPGGTVGADKLRGNVEAIAFIRAFFDQKKPVAAICHAPWTLIE
AGVLEGRTLTSYPTLKVDIENAGGAWTNEEVVVDNGLVTSRDPNDLPAFCAKLVEEIAED
VGAAPAAGN