Protein Info for GFF4838 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: 23S rRNA (guanosine-2'-O-) -methyltransferase rlmB (EC 2.1.1.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 247 TIGR00186: RNA methyltransferase, TrmH family, group 3" amino acids 5 to 246 (242 residues), 239.9 bits, see alignment E=1.4e-75 PF08032: SpoU_sub_bind" amino acids 7 to 79 (73 residues), 49.4 bits, see alignment E=4.6e-17 PF00588: SpoU_methylase" amino acids 100 to 240 (141 residues), 146.1 bits, see alignment E=7.9e-47

Best Hits

Swiss-Prot: 66% identical to RLMB_RALSO: 23S rRNA (guanosine-2'-O-)-methyltransferase RlmB (rlmB) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K03218, RNA methyltransferase, TrmH family [EC: 2.1.1.-] (inferred from 92% identity to aaa:Acav_2266)

Predicted SEED Role

"23S rRNA (guanosine-2'-O-) -methyltransferase rlmB (EC 2.1.1.-)" (EC 2.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (247 amino acids)

>GFF4838 23S rRNA (guanosine-2'-O-) -methyltransferase rlmB (EC 2.1.1.-) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MSSPKVLFGFHAVGVRLKTAPQSIIEIYYEPTRRDARMRQFLDKAREANARLIEADGLRI
AKLAGSHGHQGVAARVEAVAQVRSLDDLLEQLEPTGIPPLLLVLDGITDPHNLGACLRVA
DGAGAHAVIAPKDHAAGINATVAKVASGAAETMPYFMVTNLARTLGELKERNIWVIGTSD
DAPKTLYQVDLKGPVALVLGAEGAGMRQLTRKTCDELVSIPMAGAVESLNVSVASGVCLY
EALRQRS