Protein Info for GFF4836 in Xanthobacter sp. DMC5

Annotation: Divalent metal cation transporter MntH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 436 transmembrane" amino acids 60 to 81 (22 residues), see Phobius details amino acids 102 to 133 (32 residues), see Phobius details amino acids 140 to 158 (19 residues), see Phobius details amino acids 165 to 184 (20 residues), see Phobius details amino acids 204 to 225 (22 residues), see Phobius details amino acids 259 to 282 (24 residues), see Phobius details amino acids 306 to 331 (26 residues), see Phobius details amino acids 352 to 371 (20 residues), see Phobius details amino acids 378 to 399 (22 residues), see Phobius details amino acids 411 to 435 (25 residues), see Phobius details PF01566: Nramp" amino acids 48 to 410 (363 residues), 280.8 bits, see alignment E=8.1e-88

Best Hits

KEGG orthology group: None (inferred from 64% identity to msl:Msil_2410)

Predicted SEED Role

"Manganese transport protein MntH" in subsystem Transport of Manganese

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (436 amino acids)

>GFF4836 Divalent metal cation transporter MntH (Xanthobacter sp. DMC5)
MTDLSKGATCGTEAGSKPSIWLRLKMLTVSRLGPGLVTGAADDDPSGIATYSQIGAQFGY
AFAWTMLFSFPLMAVIQAISARIGCVTGRGIARNLRLHYSPWLLRVVIVLLLIANVINLG
ADLGAMAAALGLLVGGPEHLYVAGFAIVCVLLETFMSYARYAAVLKWATLSLFAYVAVAF
AAHVDWPVALASTFVPRIAFDGDHAMALVAVLGTTISPYLFFWQAGQEVEELRRRHVKPL
CVAPRDAGPELARIRTDTFVGMGFSNLIALFIMLATAATLHASGVTDIQTSSQAAEALRP
IAGPLTFALFAAGIIATGMLAVPVLAGSAAYGVSELFGWPEGLDRRPREAKAFYGIIAAA
ALGGVALNFTSLDPVKALYWSAVVNGVLAAPMMAVMMVISMNPRLMGRLTLPLPMLLVGW
LATVVMAAASIGLFVL